Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q71DI3 Histone H3.2 n=18712 Tax=cellular organisms TaxID=131567 RepID=H32_HUMAN MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 18,712  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q71DI3H32_HUMANHistone H3.2Homo sapiens (Human)9606UniRef100_Q71DI3
UniRef90_Q71DI3
136Representative
P84227H32_BOVINHistone H3.2Bos taurus (Bovine)9913UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84230H32_CAIMOHistone H3.2Cairina moschata (Muscovy duck)8855UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84229H32_CHICKHistone H3.2Gallus gallus (Chicken)9031UniRef100_Q71DI3
UniRef90_Q71DI3
136
Q4QRF4H32_DANREHistone H3.2Danio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84231H32_ICTBUHistone H3.2Ictiobus bubalus (Smallmouth buffalo fish) (Catostomus bubalus)7973UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84228H32_MOUSEHistone H3.2Mus musculus (Mouse)10090UniRef100_Q71DI3
UniRef90_Q71DI3
136
Q6LBE8H32_MUSPAHistone H3.2Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84234H32_ONCMYHistone H3.2Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)8022UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84232H32_PORAFHistone H3.2Poroderma africanum (Striped catshark) (Squalus afriicanus)30489UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84233H32_XENLAHistone H3.2Xenopus laevis (African clawed frog)8355UniRef100_Q71DI3
UniRef90_Q71DI3
136
Q28D37H32_XENTRHistone H3.2Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84238H3_CHITHHistone H3Chironomus thummi thummi (Midge)7155UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84236H3_DROHYHistone H3Drosophila hydei (Fruit fly)7224UniRef100_Q71DI3
UniRef90_Q71DI3
136
P02299H3_DROMEHistone H3Drosophila melanogaster (Fruit fly)7227UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84235H3_PLADUHistone H3Platynereis dumerilii (Dumeril's clam worm)6359UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84237H3_TIGCAHistone H3Tigriopus californicus (Marine copepod)6832UniRef100_Q71DI3
UniRef90_Q71DI3
136
P84239H3_URECAHistone H3Urechis caupo (Innkeeper worm) (Spoonworm)6431UniRef100_Q71DI3
UniRef90_Q71DI3
136
A0A087YSG4A0A087YSG4_POEFOHistone H3Poecilia formosa (Amazon molly) (Limia formosa)48698UniRef100_Q71DI3
UniRef90_Q71DI3
110
A0A182YQR7A0A182YQR7_ANOSTHistone H3Anopheles stephensi (Indo-Pakistan malaria mosquito)30069UniRef100_Q71DI3
UniRef90_Q71DI3
99
D7NGV7D7NGV7_9ARACHistone H3 (Fragment)Callobius sp. crater butte population752039UniRef100_Q71DI3
UniRef90_Q71DI3
123
D7NGW9D7NGW9_9ARACHistone H3 (Fragment)Callobius pauculus716902UniRef100_Q71DI3
UniRef90_Q71DI3
123
A0A0M5JGT7A0A0M5JGT7_9BIVAHistone H3 (Fragment)Acrosterigma magnum1699430UniRef100_Q71DI3
UniRef90_Q71DI3
123
A0A0D3RYI8A0A0D3RYI8_9ANNEHistone H3 (Fragment)Pectinaria hyperborea879532UniRef100_Q71DI3
UniRef90_Q71DI3
123
A0A2H4FI55A0A2H4FI55_9EUCAHistone H3 (Fragment)Ucides cordatus184468UniRef100_Q71DI3
UniRef90_Q71DI3
123

Sequence

Representative sequenceiLengthMass (Da)Tools
Q71DI3

Checksumi: 6FD8508EA50A0EEC

FASTA13615,388
        10         20         30         40         50
MARTKQTARK STGGKAPRKQ LATKAARKSA PATGGVKKPH RYRPGTVALR
60 70 80 90 100
EIRRYQKSTE LLIRKLPFQR LVREIAQDFK TDLRFQSSAV MALQEASEAY
110 120 130
LVGLFEDTNL CAIHAKRVTI MPKDIQLARR IRGERA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again