Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q748Z3 50S ribosomal protein L22 n=92 Tax=Proteobacteria TaxID=1224 RepID=RL22_GEOSL MEASAKLTFARLSPRKTRLVVDMVRGKGIQDALTILRFSPQASAKLVSKLLRSAVANAEQ KGASDVDRLYVKSISVDGGPVLKRFVPRAMGRASKIRKPTSHITVVLADKQ

Members

List component clusters with 100% or 90% identity.
1 to 25 of 92  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q748Z3RL22_GEOSL50S ribosomal protein L22Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)243231UniRef100_Q748Z3
UniRef90_Q748Z3
111Representative
Q39Y01RL22_GEOMG50S ribosomal protein L22Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)269799UniRef100_Q39Y01
UniRef90_Q748Z3
110
B5EFQ5RL22_GEOBB50S ribosomal protein L22Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)404380UniRef100_B5EFQ5
UniRef90_B5EFQ5
111
C6E4Q2RL22_GEOSM50S ribosomal protein L22Geobacter sp. (strain M21)443144UniRef100_B5EFQ5
UniRef90_B5EFQ5
111
A5GAX0RL22_GEOUR50S ribosomal protein L22Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)351605UniRef100_A5GAX0
UniRef90_B9M6H3
111
B9M6H3RL22_GEODF50S ribosomal protein L22Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)316067UniRef100_B9M6H3
UniRef90_B9M6H3
111
Q1D770RL22_MYXXD50S ribosomal protein L22Myxococcus xanthus (strain DK 1622)246197UniRef100_Q1D770
UniRef90_Q1D770
114
B3E7U0RL22_GEOLS50S ribosomal protein L22Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)398767UniRef100_B3E7U0
UniRef90_B3E7U0
113
A1ALU6RL22_PELPD50S ribosomal protein L22Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)338966UniRef100_A1ALU6
UniRef90_A1ALU6
111
A0A0D5N6C1A0A0D5N6C1_GEOSN50S ribosomal protein L22Geobacter sulfurreducens35554UniRef100_Q748Z3
UniRef90_Q748Z3
111
A0A0C1U675A0A0C1U675_9DELT50S ribosomal protein L22Geobacter soli1510391UniRef100_Q748Z3
UniRef90_Q748Z3
110
A0A3M8EU14A0A3M8EU14_9DELT50S ribosomal protein L22Desulfuromonadales bacterium2099678UniRef100_A0A3M8EU14
UniRef90_Q748Z3
110
A0A1W7QYG2A0A1W7QYG2_9DELT50S ribosomal protein L22Geobacter pelophilus60036UniRef100_A0A1W7QYG2
UniRef90_B5EFQ5
91
E8WTM5E8WTM5_GEOS850S ribosomal protein L22Geobacter sp. (strain M18)443143UniRef100_B5EFQ5
UniRef90_B5EFQ5
111
A0A3M1E2Q4A0A3M1E2Q4_9DELT50S ribosomal protein L22Deltaproteobacteria bacterium2026735UniRef100_A0A3M1E2Q4
UniRef90_A0A3M1E2Q4
110
A0A0S8IDZ6A0A0S8IDZ6_9DELT50S ribosomal protein L22Deltaproteobacteria bacterium SM23_611703399UniRef100_A0A0S8IDZ6
UniRef90_A0A0S8IDZ6
110
A0A1G0LN54A0A1G0LN54_9DELT50S ribosomal protein L22Geobacteraceae bacterium GWC2_48_71798315UniRef100_A0A1G0LN54
UniRef90_A0A1G0LN54
111
A0A1G0LX09A0A1G0LX09_9DELT50S ribosomal protein L22Geobacteraceae bacterium GWC2_55_201798317UniRef100_A0A1G0LX09
UniRef90_A0A1G0LX09
111
A0A1F9PMW0A0A1F9PMW0_9DELT50S ribosomal protein L22Desulfuromonadales bacterium GWD2_54_101797917UniRef100_A0A1F9PMW0
UniRef90_A0A1G0LX09
111
A0A1G2W7U2A0A1G2W7U2_9DELT50S ribosomal protein L22Desulfuromonadaceae bacterium GWB2_53_151801895UniRef100_A0A1F9PMW0
UniRef90_A0A1G0LX09
111
A0A212PHV8A0A212PHV8_9DELT50S ribosomal protein L22Geobacter sp. DSM 97361277350UniRef100_A0A212PHV8
UniRef90_B9M6H3
110
A0A399HZC9A0A399HZC9_9DELT50S ribosomal protein L22Geobacter sp.46610UniRef100_A0A399HZC9
UniRef90_A0A399HZC9
111
A0A2N6DZ38A0A2N6DZ38_9DELT50S ribosomal protein L22Desulfuromonas sp.892UniRef100_A0A2N6DZ38
UniRef90_A0A2N6DZ38
110
A0A2M6X3Z6A0A2M6X3Z6_9PROT50S ribosomal protein L22Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_341973927UniRef100_A0A2M6X3Z6
UniRef90_A0A2M6X3Z6
110
A0A2D8JE36A0A2D8JE36_9DELT50S ribosomal protein L22Myxococcales bacterium2026763UniRef100_A0A2D8JE36
UniRef90_A0A2D8JE36
111

Sequence

Representative sequenceiLengthMass (Da)Tools
Q748Z3

Checksumi: 31ED36AA234F5963

FASTA11112,072
        10         20         30         40         50
MEASAKLTFA RLSPRKTRLV VDMVRGKGIQ DALTILRFSP QASAKLVSKL
60 70 80 90 100
LRSAVANAEQ KGASDVDRLY VKSISVDGGP VLKRFVPRAM GRASKIRKPT
110
SHITVVLADK Q
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again