Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q7KN79 Protein LTV1 homolog n=89 Tax=Protostomia TaxID=33317 RepID=LTV1_DROME MVKGKKPYIDRKKAVTFHLVHRSQHDPLVTDENAPQRVLLEAAARQQKPKDPEPPTDPAQ RQEELKKFGIHFDDDYDYMQHLKKRENDVVWEFMENPNQARKQKVQDSEKPGPAPKLMLP SSVFASEFEESEGMLNKAAPQTLRLDWDPDVVAALDSDCENEELEDDFVIQAMAEGDSDD EEWDDEDGEEQSDMDFDSDDLNEDENEDELMDRLAPLMRERRFDDEEVKSRFTEYSMSSS VIRRNEQLSLLDDRFEKFYATYDDPELGDLALEDIEGNWHQKHPVVMQCFQEFKKKDKGI EYNKEWDRERIEKYRNVVEGEEDPTEELVEYEVDDPKQKKWDCESILSTYSNIYNHPKVI DEPRRSRRSSASTNPAPIQIDPKTGLPTNVLRGGVDGQLTAKALANLADESPAATGPKSL CAKSVLSTLSVLSIRPKDETHEEKKERKRLLKDYRNERRIEKKANTEAFKEEKKRQTHVK INQRTNQQGASIV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 89  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q7KN79LTV1_DROMEProtein LTV1 homologDrosophila melanogaster (Fruit fly)7227UniRef100_Q7KN79
UniRef90_Q7KN79
493Representative
A0A1W4VRA2A0A1W4VRA2_DROFCprotein LTV1 homologDrosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4VRA2
UniRef90_Q7KN79
494
B4P824B4P824_DROYAUncharacterized proteinDrosophila yakuba (Fruit fly)7245UniRef100_B4P824
UniRef90_Q7KN79
493
B3NN41B3NN41_DROERUncharacterized proteinDrosophila erecta (Fruit fly)7220UniRef100_B3NN41
UniRef90_Q7KN79
493
B4QAP1B4QAP1_DROSIGD25950Drosophila simulans (Fruit fly)7240UniRef100_B4QAP1
UniRef90_Q7KN79
491
B4HN12B4HN12_DROSEGM20488Drosophila sechellia (Fruit fly)7238UniRef100_B4HN12
UniRef90_Q7KN79
491
B3MIL4B3MIL4_DROANUncharacterized proteinDrosophila ananassae (Fruit fly)7217UniRef100_B3MIL4
UniRef90_Q7KN79
490
W8BXW1W8BXW1_CERCAProtein LTV1 (Fragment)Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)7213UniRef100_W8BXW1
UniRef90_W8BXW1
554Seed
A0A0M4EB33A0A0M4EB33_DROBSCG7686Drosophila busckii (Fruit fly)30019UniRef100_A0A0M4EB33
UniRef90_A0A0M4EB33
485
T1PCM0T1PCM0_MUSDOLow temperature viability proteinMusca domestica (House fly)7370UniRef100_T1PCM0
UniRef90_A0A1I8MEM0
504
A0A1I8MEM0A0A1I8MEM0_MUSDOUncharacterized proteinMusca domestica (House fly)7370UniRef100_A0A1I8MEM0
UniRef90_A0A1I8MEM0
504
A0A2A3EDZ5A0A2A3EDZ5_APICCUncharacterized proteinApis cerana cerana (Oriental honeybee)94128UniRef100_A0A2A3EDZ5
UniRef90_A0A087ZYW2
493
A0A087ZYW2A0A087ZYW2_APIMEUncharacterized proteinApis mellifera (Honeybee)7460UniRef100_A0A087ZYW2
UniRef90_A0A087ZYW2
473
V9IGT7V9IGT7_APICEProtein LTV1Apis cerana (Indian honeybee)7461UniRef100_V9IGT7
UniRef90_A0A087ZYW2
142
A0A1Q3F9N9A0A1Q3F9N9_CULTAUncharacterized proteinCulex tarsalis (Encephalitis mosquito)7177UniRef100_A0A1Q3F9N9
UniRef90_B0XJL7
488
B0XJL7B0XJL7_CULQUUncharacterized proteinCulex quinquefasciatus (Southern house mosquito) (Culex pungens)7176UniRef100_B0XJL7
UniRef90_B0XJL7
481
A0A2M3YYQ8A0A2M3YYQ8_9DIPTUncharacterized proteinAnopheles braziliensis58242UniRef100_A0A2M3YYQ8
UniRef90_W5JI14
486
A0A2M4BLK6A0A2M4BLK6_9DIPTUncharacterized proteinAnopheles marajoara58244UniRef100_A0A2M4BLK6
UniRef90_W5JI14
487
A0A2M4BQ18A0A2M4BQ18_9DIPTUncharacterized protein (Fragment)Anopheles marajoara58244UniRef100_A0A2M4BLK6
UniRef90_W5JI14
420
A0A2M4BLT7A0A2M4BLT7_9DIPTUncharacterized proteinAnopheles marajoara58244UniRef100_A0A2M4BLT7
UniRef90_W5JI14
487
A0A2M4A2Q8A0A2M4A2Q8_9DIPTUncharacterized proteinAnopheles triannulatus58253UniRef100_A0A2M4A2Q8
UniRef90_W5JI14
487
A0A2M4A366A0A2M4A366_9DIPTUncharacterized proteinAnopheles triannulatus58253UniRef100_A0A2M4A366
UniRef90_W5JI14
487
A0A2M3YYF9A0A2M3YYF9_9DIPTUncharacterized proteinAnopheles braziliensis58242UniRef100_A0A2M3YYF9
UniRef90_W5JI14
486
W5JI14W5JI14_ANODAProtein LTV1Anopheles darlingi (Mosquito)43151UniRef100_W5JI14
UniRef90_W5JI14
486
A0A484B7S6A0A484B7S6_DRONAUncharacterized proteinDrosophila navojoa (Fruit fly)7232UniRef100_A0A484B7S6
UniRef90_A0A484B7S6
488

Sequence

Representative sequenceiLengthMass (Da)Tools
Q7KN79

Checksumi: B59F442FA30BC58C

FASTA49357,223
        10         20         30         40         50
MVKGKKPYID RKKAVTFHLV HRSQHDPLVT DENAPQRVLL EAAARQQKPK
60 70 80 90 100
DPEPPTDPAQ RQEELKKFGI HFDDDYDYMQ HLKKRENDVV WEFMENPNQA
110 120 130 140 150
RKQKVQDSEK PGPAPKLMLP SSVFASEFEE SEGMLNKAAP QTLRLDWDPD
160 170 180 190 200
VVAALDSDCE NEELEDDFVI QAMAEGDSDD EEWDDEDGEE QSDMDFDSDD
210 220 230 240 250
LNEDENEDEL MDRLAPLMRE RRFDDEEVKS RFTEYSMSSS VIRRNEQLSL
260 270 280 290 300
LDDRFEKFYA TYDDPELGDL ALEDIEGNWH QKHPVVMQCF QEFKKKDKGI
310 320 330 340 350
EYNKEWDRER IEKYRNVVEG EEDPTEELVE YEVDDPKQKK WDCESILSTY
360 370 380 390 400
SNIYNHPKVI DEPRRSRRSS ASTNPAPIQI DPKTGLPTNV LRGGVDGQLT
410 420 430 440 450
AKALANLADE SPAATGPKSL CAKSVLSTLS VLSIRPKDET HEEKKERKRL
460 470 480 490
LKDYRNERRI EKKANTEAFK EEKKRQTHVK INQRTNQQGA SIV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again