Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q7UN05 50S ribosomal protein L6 n=515 RepID=RL6_RHOBA MSRIGNKPVAIPSGVTVSIADRNIDVEGPKGKLSFKHRPEVKVAVDSDTNQVIVSRDGDD RPSREFHGLTRAIVANMLVGVKDGYEKKLEIVGVGYLASISGDTLQLRVGYANELHRKIP TDLTVTCPDQTHVVIQGCDKQSVGQFAAEIRSLRKPEPYKGKGIRYQGEQVKIKPGKSAT K

Members

List component clusters with 100% or 90% identity.
1 to 25 of 515  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q7UN05RL6_RHOBA50S ribosomal protein L6Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)243090UniRef100_Q7UN05
UniRef90_Q7UN05
181Representative
Q16AC9RL6_ROSDO50S ribosomal protein L6Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)375451UniRef100_Q16AC9
UniRef90_Q16AC9
177
Q0ANR5RL6_MARMM50S ribosomal protein L6Maricaulis maris (strain MCS10)394221UniRef100_Q0ANR5
UniRef90_Q0ANR5
177
A0LIK5RL6_SYNFM50S ribosomal protein L6Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)335543UniRef100_A0LIK5
UniRef90_A0LIK5
179
Q2N9C6RL6_ERYLH50S ribosomal protein L6Erythrobacter litoralis (strain HTCC2594)314225UniRef100_Q2N9C6
UniRef90_Q2N9C6
177
A4TEC2RL6_MYCGI50S ribosomal protein L6Mycolicibacterium gilvum (strain PYR-GCK) (Mycobacterium gilvum (strain PYR-GCK))350054UniRef100_A4TEC2
UniRef90_A4TEC2
179
A1T4S1RL6_MYCVP50S ribosomal protein L6Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / NRRL B-24157 / PYR-1) (Mycobacterium vanbaalenii)350058UniRef100_A1T4S1
UniRef90_A1T4S1
179
A0A2G1W8H8A0A2G1W8H8_9PLAN50S ribosomal protein L6Rhodopirellula bahusiensis2014065UniRef100_A0A2G1W8H8
UniRef90_Q7UN05
181
A0A2D9JDV9A0A2D9JDV9_9PLAN50S ribosomal protein L6Rhodopirellula sp.2024855UniRef100_A0A2D9JDV9
UniRef90_Q7UN05
181
F2AT50F2AT50_RHOBT50S ribosomal protein L6Rhodopirellula baltica WH47991778UniRef100_F2AT50
UniRef90_Q7UN05
181
L7CJ00L7CJ00_RHOBT50S ribosomal protein L6Rhodopirellula baltica SWK14993516UniRef100_F2AT50
UniRef90_Q7UN05
181
A0A0J1BMP4A0A0J1BMP4_RHOIS50S ribosomal protein L6Rhodopirellula islandica595434UniRef100_A0A0J1BMP4
UniRef90_Q7UN05
181
M2AU28M2AU28_9PLAN50S ribosomal protein L6Rhodopirellula europaea 6C1263867UniRef100_M2AU28
UniRef90_Q7UN05
181
M5S5H3M5S5H3_9PLAN50S ribosomal protein L6Rhodopirellula europaea SH3981263868UniRef100_M2AU28
UniRef90_Q7UN05
181
K5DB18K5DB18_RHOBT50S ribosomal protein L6Rhodopirellula baltica SH28993517UniRef100_K5DB18
UniRef90_Q7UN05
156
A0A3D4J3Y0A0A3D4J3Y0_9FIRM50S ribosomal protein L6Erysipelotrichaceae bacterium2049044UniRef100_A0A3D4J3Y0
UniRef90_B7CA16
181
A0A395W439A0A395W439_9FIRM50S ribosomal protein L6Holdemanella biformis1735UniRef100_A0A3D4J3Y0
UniRef90_B7CA16
181
B7CA16B7CA16_9FIRM50S ribosomal protein L6Holdemanella biformis DSM 3989518637UniRef100_B7CA16
UniRef90_B7CA16
181
A0A412IZP5A0A412IZP5_9FIRM50S ribosomal protein L6Holdemanella biformis1735UniRef100_B7CA16
UniRef90_B7CA16
181
A0A412HYB0A0A412HYB0_9FIRM50S ribosomal protein L6Eubacterium sp. AF22-8LB2292232UniRef100_A0A412HYB0
UniRef90_B7CA16
181
A0A374QVV4A0A374QVV4_9FIRM50S ribosomal protein L6Eubacterium sp. TM06-472292354UniRef100_A0A374QVV4
UniRef90_B7CA16
181
A0A374RH47A0A374RH47_9FIRM50S ribosomal protein L6Eubacterium sp. TM05-532292353UniRef100_A0A374RH47
UniRef90_B7CA16
181
A0A414J9C5A0A414J9C5_9FIRM50S ribosomal protein L6Eubacterium sp. AM28-292292349UniRef100_A0A414J9C5
UniRef90_B7CA16
181
A0A355QJ00A0A355QJ00_9ACTN50S ribosomal protein L6Acidimicrobiaceae bacterium2024894UniRef100_A0A355QJ00
UniRef90_A0A355QJ00
179
A0A381R2W8A0A381R2W8_9ZZZZUncharacterized proteinmarine metagenome408172UniRef100_A0A355QJ00
UniRef90_A0A355QJ00
179

Sequence

Representative sequenceiLengthMass (Da)Tools
Q7UN05

Checksumi: 4207D810F11D8760

FASTA18119,734
        10         20         30         40         50
MSRIGNKPVA IPSGVTVSIA DRNIDVEGPK GKLSFKHRPE VKVAVDSDTN
60 70 80 90 100
QVIVSRDGDD RPSREFHGLT RAIVANMLVG VKDGYEKKLE IVGVGYLASI
110 120 130 140 150
SGDTLQLRVG YANELHRKIP TDLTVTCPDQ THVVIQGCDK QSVGQFAAEI
160 170 180
RSLRKPEPYK GKGIRYQGEQ VKIKPGKSAT K
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again