Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q80872 Non-structural protein 2a n=104 Tax=Orthocoronavirinae TaxID=2501931 RepID=NS2A_CVHOC MAVAYADKPNHFINFPLTHFQGFVLNYKGLQFQILDEGVDCKIQTAPHISLTMLDIQPED YKSVDVAIQEVIDDMHWGDGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVA DQSRKWIGHCTIAQLTDAALSIKENVDFINSMQFNYKITINPSSPARLEIVKLGAEKKDG FYETIVSHWMGIRFEYTSPTDKLAMIMGYCCLDVVRKELEEGDLPENDDDAWFKLSYHYE NNSWFFRHVYRKSFHFRKACQNLDCNCLGFYESPVEED

Members

List component clusters with 100% or 90% identity.
1 to 25 of 104  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q80872NS2A_CVHOCNon-structural protein 2aHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_Q80872
UniRef90_Q80872
278Representative
Q91A27NS2A_CVBENNon-structural protein 2aBovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)233262UniRef100_Q91A27
UniRef90_Q80872
278Seed
Q9QAS3NS2A_CVBLYNon-structural protein 2aBovine coronavirus (strain LY-138) (BCoV) (BCV)11131UniRef100_Q9QAS3
UniRef90_Q80872
278
Q80B88NS2A_CVBMNon-structural protein 2aBovine coronavirus (strain Mebus) (BCoV) (BCV)11132UniRef100_Q80B88
UniRef90_Q80872
278
P0C2R3NS2A_CVBLSNon-structural protein 2aBovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)233261UniRef100_P0C2R3
UniRef90_Q80872
278
P0C2R4NS2A_CVBOKNon-structural protein 2aBovine coronavirus (strain OK-0514) (BCoV) (BCV)231432UniRef100_P0C2R3
UniRef90_Q80872
278
Q8V438NS2A_CVBLUNon-structural protein 2aBovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)233264UniRef100_Q8V438
UniRef90_Q80872
278
P18517NS2A_CVBQNon-structural protein 2aBovine coronavirus (strain Quebec) (BCoV) (BCV)11133UniRef100_P18517
UniRef90_Q80872
277
A0A1S6KXQ6A0A1S6KXQ6_9BETCNon-structural protein 2aCanine respiratory coronavirus215681UniRef100_A0A1S6KXQ6
UniRef90_Q80872
278
A0A3S7H195A0A3S7H195_9BETCNon-structural protein 2aBovine coronavirus11128UniRef100_A0A3S7H195
UniRef90_Q80872
278
A0A1S5VGA7A0A1S5VGA7_CVHOCNon-structural protein 2aHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A1S5VGA7
UniRef90_Q80872
278
D0EY91D0EY91_9BETCNon-structural protein 2aCanine respiratory coronavirus215681UniRef100_D0EY91
UniRef90_Q80872
278
A0A1V0PL34A0A1V0PL34_CVHOCNon-structural protein 2aHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A1V0PL34
UniRef90_Q80872
278
A0A1W6DZX8A0A1W6DZX8_CVHOCNS2aHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A1W6DZX8
UniRef90_Q80872
278
A0A191URA9A0A191URA9_9BETCNon-structural protein 2aBetacoronavirus 1694003UniRef100_A0A191URA9
UniRef90_Q80872
278
A0A0K0L8D2A0A0K0L8D2_CVHOCNon-structural proteinHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A0K0L8D2
UniRef90_Q80872
278
A0A2Z4HFP1A0A2Z4HFP1_CVHOCNS2a proteinHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A2Z4HFP1
UniRef90_Q80872
278
A0A2R4STT5A0A2R4STT5_9BETCNon-structural protein 2aBovine coronavirus11128UniRef100_A0A2R4STT5
UniRef90_Q80872
278
U3M781U3M781_CVHOCNon-structural protein 2aHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_U3M781
UniRef90_Q80872
278
B8RIQ5B8RIQ5_9BETCNon-structural protein 2aCanine respiratory coronavirus215681UniRef100_B8RIQ5
UniRef90_Q80872
278
Q0PL41Q0PL41_9BETCNon-structural protein 2aBovine coronavirus DB2398808UniRef100_Q0PL41
UniRef90_Q80872
278
C6GHL1C6GHL1_9BETCNon-structural protein 2aBovine coronavirus E-DB2-TC422216UniRef100_Q0PL41
UniRef90_Q80872
278
A0A0K0L8H6A0A0K0L8H6_CVHOCNS2 proteinHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A0K0L8H6
UniRef90_Q80872
278
A0A0K0L987A0A0K0L987_CVHOCNonstructural proteinHuman coronavirus OC43 (HCoV-OC43)31631UniRef100_A0A0K0L987
UniRef90_Q80872
278
A0A3S7GY36A0A3S7GY36_9BETCNon-structural protein 2aBovine coronavirus11128UniRef100_A0A3S7GY36
UniRef90_Q80872
278

Sequence

Representative sequenceiLengthMass (Da)Tools
Q80872

Checksumi: DE098BF595F57AE0

FASTA27832,216
        10         20         30         40         50
MAVAYADKPN HFINFPLTHF QGFVLNYKGL QFQILDEGVD CKIQTAPHIS
60 70 80 90 100
LTMLDIQPED YKSVDVAIQE VIDDMHWGDG FQIKFENPHI LGRCIVLDVK
110 120 130 140 150
GVEELHDDLV NYIRDKGCVA DQSRKWIGHC TIAQLTDAAL SIKENVDFIN
160 170 180 190 200
SMQFNYKITI NPSSPARLEI VKLGAEKKDG FYETIVSHWM GIRFEYTSPT
210 220 230 240 250
DKLAMIMGYC CLDVVRKELE EGDLPENDDD AWFKLSYHYE NNSWFFRHVY
260 270
RKSFHFRKAC QNLDCNCLGF YESPVEED
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again