Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q8BGW0 Protein THEMIS n=381 Tax=Amniota TaxID=32524 RepID=THMS1_MOUSE MALSLEEFVYSLDLRTLPRVLEIQSGIYFEGSVYEMFGNECCLSTGEVIKITGLKIKKMM AEICEGAIGGCESQKPFELPMNFPGLFKVMADKTPYLSIEEITRTVNIGPSRLGHPCFYH LKDIKLENLIIKQGEPIRFNSVEEINGETLVNCGVVRNHQSHSFTLPLSQEGEFYECEDE HIYTLKEIVEWKIPKNRTRTVKLTDFSNKWDSTNPFPEDFYGTLILKPVYEIQGVLKFQK DIVRILPSLDVEVKDITDSYDANWFLQLLSTDDLFEMTSKEFPVVAEVVEISQGNHLPQS ILQREKTIVIHKKYQASRILASEIRSNFPKRHFLIPISYKGKFKRRPREFPTAYDLQIAK SRKETLHVVATKAFHTLHKELSPVSVGDQFLVHHSETTEVVFEGTRKVNVLTCEKVLNKT REDAQLPLYMEGGFVEVIHDKKQYQISELCTQFCWPFNVKVAVRDLSIKDDILAATPGLQ LEEDITDSYLLISDFANPEECWEIPMSRLNMTVRLVNGSSLPADAGLLQVRSFVEEITEE QYYMMRRYESSLSHPPPRPPKHPSAEEMKLTLLSLAEERTINLPKSLKSHHVDRPKKLPS DESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 381  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8BGW0THMS1_MOUSEProtein THEMISMus musculus (Mouse)10090UniRef100_Q8BGW0
UniRef90_Q8BGW0
636Representative
Q8BGW0-2Isoform 2 of THMS1_MOUSE2Mus musculus (Mouse)10090UniRef100_Q8BGW0-2
UniRef90_Q8BGW0
605
Q8BGW0-3Isoform 3 of THMS1_MOUSE3Mus musculus (Mouse)10090UniRef100_Q8BGW0-3
UniRef90_Q8BGW0
595
Q8BGW0-4Isoform 4 of THMS1_MOUSE4Mus musculus (Mouse)10090UniRef100_Q8BGW0-4
UniRef90_Q8BGW0
512
F7H830F7H830_CALJAThymocyte selection associatedCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7H830
UniRef90_A0A2K6JTD7
641
A0A2K6JTD7A0A2K6JTD7_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6JTD7
UniRef90_A0A2K6JTD7
661
A0A096N8U0A0A096N8U0_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096N8U0
UniRef90_A0A2K6JTD7
655
A0A2K5EVQ7A0A2K5EVQ7_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5EVQ7
UniRef90_A0A2K6JTD7
647
A0A2K6PM34A0A2K6PM34_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PM34
UniRef90_A0A2K6JTD7
642
A0A2K5PG86A0A2K5PG86_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5PG86
UniRef90_A0A2K6JTD7
641
A0A2K5I2U1A0A2K5I2U1_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5I2U1
UniRef90_A0A2K6JTD7
641
A0A2K6UU37A0A2K6UU37_SAIBBThymocyte selection associatedSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6UU37
UniRef90_A0A2K6JTD7
639
A0A091M775A0A091M775_CARICProtein THEMIS (Fragment)Cariama cristata (Red-legged seriema)54380UniRef100_A0A091M775
UniRef90_A0A091VVX6
562
A0A091LIS1A0A091LIS1_9GRUIProtein THEMIS (Fragment)Chlamydotis macqueenii (Macqueen's bustard)187382UniRef100_A0A091LIS1
UniRef90_A0A091VVX6
531
A0A091G5J4A0A091G5J4_9AVESProtein THEMIS (Fragment)Cuculus canorus (common cuckoo)55661UniRef100_A0A091G5J4
UniRef90_A0A091VVX6
530
A0A0A0A749A0A0A0A749_CHAVOProtein THEMIS (Fragment)Charadrius vociferus (Killdeer) (Aegialitis vocifera)50402UniRef100_A0A0A0A749
UniRef90_A0A091VVX6
530
A0A091VVX6A0A091VVX6_OPIHOProtein THEMIS (Fragment)Opisthocomus hoazin (Hoatzin) (Phasianus hoazin)30419UniRef100_A0A091VVX6
UniRef90_A0A091VVX6
530
F2VRB2F2VRB2_CAMBAUncharacterized protein (Fragment)Camelus bactrianus (Bactrian camel)9837UniRef100_F2VRB2
UniRef90_F2VRB2
142
H0ZND6H0ZND6_TAEGUUncharacterized proteinTaeniopygia guttata (Zebra finch) (Poephila guttata)59729UniRef100_H0ZND6
UniRef90_H0ZND6
562
A0A218V430A0A218V430_9PASEProtein THEMISLonchura striata domestica (Bengalese finch)299123UniRef100_A0A218V430
UniRef90_H0ZND6
610
F1M3E4F1M3E4_RATRCG57294, isoform CRA_aRattus norvegicus (Rat)10116UniRef100_F1M3E4
UniRef90_F1M3E4
631
K7FVQ8K7FVQ8_PELSIThymocyte selection associatedPelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis)13735UniRef100_K7FVQ8
UniRef90_K7FVQ8
585
K7FVQ4K7FVQ4_PELSIThymocyte selection associatedPelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis)13735UniRef100_K7FVQ4
UniRef90_K7FVQ8
562
A0A093I3C8A0A093I3C8_STRCAProtein THEMIS (Fragment)Struthio camelus australis441894UniRef100_A0A093I3C8
UniRef90_A0A093I3C8
562
A0A087V6C7A0A087V6C7_BALREProtein THEMIS (Fragment)Balearica regulorum gibbericeps (East African grey crowned-crane)100784UniRef100_A0A087V6C7
UniRef90_A0A091T7K4
485

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8BGW0

Checksumi: 695B904A539110B8

FASTA63672,780
        10         20         30         40         50
MALSLEEFVY SLDLRTLPRV LEIQSGIYFE GSVYEMFGNE CCLSTGEVIK
60 70 80 90 100
ITGLKIKKMM AEICEGAIGG CESQKPFELP MNFPGLFKVM ADKTPYLSIE
110 120 130 140 150
EITRTVNIGP SRLGHPCFYH LKDIKLENLI IKQGEPIRFN SVEEINGETL
160 170 180 190 200
VNCGVVRNHQ SHSFTLPLSQ EGEFYECEDE HIYTLKEIVE WKIPKNRTRT
210 220 230 240 250
VKLTDFSNKW DSTNPFPEDF YGTLILKPVY EIQGVLKFQK DIVRILPSLD
260 270 280 290 300
VEVKDITDSY DANWFLQLLS TDDLFEMTSK EFPVVAEVVE ISQGNHLPQS
310 320 330 340 350
ILQREKTIVI HKKYQASRIL ASEIRSNFPK RHFLIPISYK GKFKRRPREF
360 370 380 390 400
PTAYDLQIAK SRKETLHVVA TKAFHTLHKE LSPVSVGDQF LVHHSETTEV
410 420 430 440 450
VFEGTRKVNV LTCEKVLNKT REDAQLPLYM EGGFVEVIHD KKQYQISELC
460 470 480 490 500
TQFCWPFNVK VAVRDLSIKD DILAATPGLQ LEEDITDSYL LISDFANPEE
510 520 530 540 550
CWEIPMSRLN MTVRLVNGSS LPADAGLLQV RSFVEEITEE QYYMMRRYES
560 570 580 590 600
SLSHPPPRPP KHPSAEEMKL TLLSLAEERT INLPKSLKSH HVDRPKKLPS
610 620 630
DESGQDSRAP VGFQNDVADV ERQKSKHGPL QPQAPL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again