Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q8BGW0 Protein THEMIS n=313 Tax=Sarcopterygii TaxID=8287 RepID=THMS1_MOUSE MALSLEEFVYSLDLRTLPRVLEIQSGIYFEGSVYEMFGNECCLSTGEVIKITGLKIKKMM AEICEGAIGGCESQKPFELPMNFPGLFKVMADKTPYLSIEEITRTVNIGPSRLGHPCFYH LKDIKLENLIIKQGEPIRFNSVEEINGETLVNCGVVRNHQSHSFTLPLSQEGEFYECEDE HIYTLKEIVEWKIPKNRTRTVKLTDFSNKWDSTNPFPEDFYGTLILKPVYEIQGVLKFQK DIVRILPSLDVEVKDITDSYDANWFLQLLSTDDLFEMTSKEFPVVAEVVEISQGNHLPQS ILQREKTIVIHKKYQASRILASEIRSNFPKRHFLIPISYKGKFKRRPREFPTAYDLQIAK SRKETLHVVATKAFHTLHKELSPVSVGDQFLVHHSETTEVVFEGTRKVNVLTCEKVLNKT REDAQLPLYMEGGFVEVIHDKKQYQISELCTQFCWPFNVKVAVRDLSIKDDILAATPGLQ LEEDITDSYLLISDFANPEECWEIPMSRLNMTVRLVNGSSLPADAGLLQVRSFVEEITEE QYYMMRRYESSLSHPPPRPPKHPSAEEMKLTLLSLAEERTINLPKSLKSHHVDRPKKLPS DESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 313  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8BGW0THMS1_MOUSEProtein THEMISMus musculus (Mouse)10090UniRef100_Q8BGW0
UniRef90_Q8BGW0
636Representative
A5D789THMS1_BOVINProtein THEMISBos taurus (Bovine)9913UniRef100_A5D789
UniRef90_A5D789
641
Q8N1K5THMS1_HUMANProtein THEMISHomo sapiens (Human)9606UniRef100_Q8N1K5
UniRef90_Q8N1K5
641
Q8BGW0-2Isoform 2 of THMS1_MOUSE2Mus musculus (Mouse)10090UniRef100_Q8BGW0-2
UniRef90_Q8BGW0
605
Q8BGW0-3Isoform 3 of THMS1_MOUSE3Mus musculus (Mouse)10090UniRef100_Q8BGW0-3
UniRef90_Q8BGW0
595
Q8BGW0-4Isoform 4 of THMS1_MOUSE4Mus musculus (Mouse)10090UniRef100_Q8BGW0-4
UniRef90_Q8BGW0
512
A0A3Q2IDT7A0A3Q2IDT7_HORSEThymocyte selection associatedEquus caballus (Horse)9796UniRef100_A0A3Q2IDT7
UniRef90_A0A3Q2IDT7
650
F7DRW2F7DRW2_HORSEThymocyte selection associatedEquus caballus (Horse)9796UniRef100_F7DRW2
UniRef90_A0A3Q2IDT7
647
A0A3Q2H186A0A3Q2H186_HORSEThymocyte selection associatedEquus caballus (Horse)9796UniRef100_A0A3Q2H186
UniRef90_A0A3Q2IDT7
599
F2VRB3F2VRB3_CERSICABIT domain-containing protein (Fragment)Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)9807UniRef100_F2VRB3
UniRef90_A0A3Q2IDT7
142
A0A4W2IR99A0A4W2IR99_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2IR99
UniRef90_A5D789
687
A0A4W2D1I3A0A4W2D1I3_BOBOXThymocyte selection associatedBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2D1I3
UniRef90_A5D789
642
L8IEV3L8IEV3_9CETAProtein THEMISBos mutus (wild yak)72004UniRef100_L8IEV3
UniRef90_A5D789
642
A0A452FBJ9A0A452FBJ9_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452FBJ9
UniRef90_A5D789
641
A0A4W2EEX7A0A4W2EEX7_BOBOXThymocyte selection associatedBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2EEX7
UniRef90_A5D789
641
W5PVH7W5PVH7_SHEEPUncharacterized proteinOvis aries (Sheep)9940UniRef100_W5PVH7
UniRef90_A5D789
641
A0A4W2IRT3A0A4W2IRT3_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2IRT3
UniRef90_A5D789
641
A0A452FBL8A0A452FBL8_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452FBL8
UniRef90_A5D789
617
H3AMY8H3AMY8_LATCHThymocyte selection associatedLatimeria chalumnae (Coelacanth)7897UniRef100_H3AMY8
UniRef90_H3AMY8
564
A0A091NFS7A0A091NFS7_9PASSProtein THEMIS (Fragment)Acanthisitta chloris (rifleman)57068UniRef100_A0A091NFS7
UniRef90_A0A091NFS7
562
S7P651S7P651_MYOBRProtein THEMISMyotis brandtii (Brandt's bat)109478UniRef100_S7P651
UniRef90_G1NSV8
795Seed
G1NSV8G1NSV8_MYOLUUncharacterized proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1NSV8
UniRef90_G1NSV8
630
A0A1V4JM12A0A1V4JM12_PATFAProtein THEMIS isoform BPatagioenas fasciata monilis372326UniRef100_A0A1V4JM12
UniRef90_A0A1V4JLV9
689
A0A2I0MVN8A0A2I0MVN8_COLLIThymocyte selection associatedColumba livia (Rock dove)8932UniRef100_A0A2I0MVN8
UniRef90_A0A1V4JLV9
713
A0A1V4JLV9A0A1V4JLV9_PATFAProtein THEMIS isoform APatagioenas fasciata monilis372326UniRef100_A0A1V4JLV9
UniRef90_A0A1V4JLV9
695

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8BGW0

Checksumi: 695B904A539110B8

FASTA63672,780
        10         20         30         40         50
MALSLEEFVY SLDLRTLPRV LEIQSGIYFE GSVYEMFGNE CCLSTGEVIK
60 70 80 90 100
ITGLKIKKMM AEICEGAIGG CESQKPFELP MNFPGLFKVM ADKTPYLSIE
110 120 130 140 150
EITRTVNIGP SRLGHPCFYH LKDIKLENLI IKQGEPIRFN SVEEINGETL
160 170 180 190 200
VNCGVVRNHQ SHSFTLPLSQ EGEFYECEDE HIYTLKEIVE WKIPKNRTRT
210 220 230 240 250
VKLTDFSNKW DSTNPFPEDF YGTLILKPVY EIQGVLKFQK DIVRILPSLD
260 270 280 290 300
VEVKDITDSY DANWFLQLLS TDDLFEMTSK EFPVVAEVVE ISQGNHLPQS
310 320 330 340 350
ILQREKTIVI HKKYQASRIL ASEIRSNFPK RHFLIPISYK GKFKRRPREF
360 370 380 390 400
PTAYDLQIAK SRKETLHVVA TKAFHTLHKE LSPVSVGDQF LVHHSETTEV
410 420 430 440 450
VFEGTRKVNV LTCEKVLNKT REDAQLPLYM EGGFVEVIHD KKQYQISELC
460 470 480 490 500
TQFCWPFNVK VAVRDLSIKD DILAATPGLQ LEEDITDSYL LISDFANPEE
510 520 530 540 550
CWEIPMSRLN MTVRLVNGSS LPADAGLLQV RSFVEEITEE QYYMMRRYES
560 570 580 590 600
SLSHPPPRPP KHPSAEEMKL TLLSLAEERT INLPKSLKSH HVDRPKKLPS
610 620 630
DESGQDSRAP VGFQNDVADV ERQKSKHGPL QPQAPL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again