Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q8IUX4-3 Isoform 3 of DNA dC->dU-editing enzyme APOBEC-3F n=7 Tax=Catarrhini TaxID=9526 RepID=Isoform 3 of ABC3F_HUMAN MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPR SFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP

Members

List component clusters with 100% or 90% identity.
1 to 7 of 7  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8IUX4-3Isoform 3 of ABC3F_HUMAN3Homo sapiens (Human)9606UniRef100_Q8IUX4-3
UniRef90_Q8IUX4-3
101Representative
G3QWZ0G3QWZ0_GORGOApolipoprotein B mRNA editing enzyme catalytic subunit 3FGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QWZ0
UniRef90_Q8IUX4-3
101
H2R2C8H2R2C8_PANTRAPOBEC3F isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_H2R2C8
UniRef90_Q8IUX4-3
101Seed
A0A2R9AMD2A0A2R9AMD2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9AMD2
UniRef90_Q8IUX4-3
101
G1SB91G1SB91_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1SB91
UniRef90_G1SB91
87
A0A2K6KN52A0A2K6KN52_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KN52
UniRef90_A0A2K6KN52
94
UPI000CEF9A00DNA dC->dU-editing enzyme APOBEC-3F isoform X4Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_UPI000CEF9A00
UniRef90_Q8IUX4-3
101

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8IUX4-3

Checksumi: 1659A5E223CB1EFE

FASTA10111,823
        10         20         30         40         50
MKPHFRNTVE RMYRDTFSYN FYNRPILSRR NTVWLCYEVK TKGPSRPRLD
60 70 80 90 100
AKIFRGQVPR SFIRAPFQVL SSPFGQCAPP HGTAQVQWPP QLTAGREQGR

P
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again