Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q8N3I7 Bardet-Biedl syndrome 5 protein n=381 Tax=Eukaryota TaxID=2759 RepID=BBS5_HUMAN MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWH SLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRL FTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTF FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV EKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFV AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 381  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8N3I7BBS5_HUMANBardet-Biedl syndrome 5 proteinHomo sapiens (Human)9606UniRef100_Q8N3I7
UniRef90_Q8N3I7
341Representative
Q4R649BBS5_MACFABardet-Biedl syndrome 5 protein homologMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q4R649
UniRef90_Q8N3I7
341
Q7ZWB7BBS5_DANREBardet-Biedl syndrome 5 protein homologDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q7ZWB7
UniRef90_Q7ZWB7
342
A0A0S2Z626A0A0S2Z626_HUMANBardet-Biedl syndrome 5 isoform 1 (Fragment)Homo sapiens (Human)9606UniRef100_Q8N3I7
UniRef90_Q8N3I7
341
K7CV40K7CV40_PANTRBardet-Biedl syndrome 5 protein homologPan troglodytes (Chimpanzee)9598UniRef100_Q8N3I7
UniRef90_Q8N3I7
341
A0A2R9BWT6A0A2R9BWT6_PANPABardet-Biedl syndrome 5 protein homologPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q8N3I7
UniRef90_Q8N3I7
341
A0A2I2ZW94A0A2I2ZW94_GORGOBardet-Biedl syndrome 5 protein homologGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZW94
UniRef90_Q8N3I7
341
A0A2K5CK52A0A2K5CK52_AOTNABardet-Biedl syndrome 5 protein homologAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CK52
UniRef90_Q8N3I7
341
H2P7R4H2P7R4_PONABBardet-Biedl syndrome 5 protein homologPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2P7R4
UniRef90_Q8N3I7
341
A0A2I2Z8B3A0A2I2Z8B3_GORGOBardet-Biedl syndrome 5 protein homologGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z8B3
UniRef90_Q8N3I7
341
H9Z224H9Z224_MACMUBardet-Biedl syndrome 5 protein homologMacaca mulatta (Rhesus macaque)9544UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K6NDM7A0A2K6NDM7_RHIROBardet-Biedl syndrome 5 protein homologRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K5LNC6A0A2K5LNC6_CERATBardet-Biedl syndrome 5 protein homologCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A096NZB9A0A096NZB9_PAPANBardet-Biedl syndrome 5 protein homologPapio anubis (Olive baboon)9555UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A0D9RRT6A0A0D9RRT6_CHLSBBardet-Biedl syndrome 5 protein homologChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K5Z6D8A0A2K5Z6D8_MANLEBardet-Biedl syndrome 5 protein homologMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_Q4R649
UniRef90_Q8N3I7
341
G7PKR7G7PKR7_MACFABardet-Biedl syndrome 5 protein homologMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K6KG14A0A2K6KG14_RHIBEBardet-Biedl syndrome 5 protein homologRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K6CE66A0A2K6CE66_MACNEBardet-Biedl syndrome 5 protein homologMacaca nemestrina (Pig-tailed macaque)9545UniRef100_Q4R649
UniRef90_Q8N3I7
341
A0A2K5HZ63A0A2K5HZ63_COLAPBardet-Biedl syndrome 5 protein homologColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HZ63
UniRef90_Q8N3I7
341
A0A1S3GBJ6A0A1S3GBJ6_DIPORBardet-Biedl syndrome 5 protein homologDipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3GBJ6
UniRef90_Q8N3I7
341
F7EG67F7EG67_CALJABardet-Biedl syndrome 5 protein homologCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7EG67
UniRef90_Q8N3I7
341
G1QY66G1QY66_NOMLEBardet-Biedl syndrome 5 protein homologNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1QY66
UniRef90_Q8N3I7
341
A0A2K5U1J1A0A2K5U1J1_MACFABardet-Biedl syndrome 5 protein homologMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5U1J1
UniRef90_Q8N3I7
340
A0A2K6NDP7A0A2K6NDP7_RHIROBardet-Biedl syndrome 5 protein homologRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K5U1J1
UniRef90_Q8N3I7
340

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8N3I7

Checksumi: 63D67D877FDFD25B

FASTA34138,755
        10         20         30         40         50
MSVLDALWED RDVRFDLSAQ QMKTRPGEVL IDCLDSIEDT KGNNGDRGRL
60 70 80 90 100
LVTNLRILWH SLALSRVNVS VGYNCILNIT TRTANSKLRG QTEALYILTK
110 120 130 140 150
CNSTRFEFIF TNLVPGSPRL FTSVMAVHRA YETSKMYRDF KLRSALIQNK
160 170 180 190 200
QLRLLPQEHV YDKINGVWNL SSDQGNLGTF FITNVRIVWH ANMNDSFNVS
210 220 230 240 250
IPYLQIRSIK IRDSKFGLAL VIESSQQSGG YVLGFKIDPV EKLQESVKEI
260 270 280 290 300
NSLHKVYSAS PIFGVDYEME EKPQPLEALT VEQIQDDVEI DSDGHTDAFV
310 320 330 340
AYFADGNKQQ DREPVFSEEL GLAIEKLKDG FTLQGLWEVM S
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again