Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q8TGU5 Uncharacterized protein YBR296C-A n=6 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=YB296_YEAST MKVLDDWFSRKFSKAVHGNNHGTISLSTLSYIRVHKLVK

Members

List component clusters with 100% or 90% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8TGU5YB296_YEASTUncharacterized protein YBR296C-ASaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_Q8TGU5
UniRef90_Q8TGU5
39Representative & Seed
G2W9V0G2W9V0_YEASKK7_Ybr296c-apSaccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)721032UniRef100_Q8TGU5
UniRef90_Q8TGU5
39
D3UF44D3UF44_YEAS8EC1118_1B15_4830pSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)643680UniRef100_Q8TGU5
UniRef90_Q8TGU5
39
C7GMT6C7GMT6_YEAS2YBR296C-A-like proteinSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)574961UniRef100_Q8TGU5
UniRef90_Q8TGU5
39
A6ZLN4A6ZLN4_YEAS7Conserved proteinSaccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796UniRef100_Q8TGU5
UniRef90_Q8TGU5
39
B3LML7B3LML7_YEAS1Uncharacterized proteinSaccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)285006UniRef100_Q8TGU5
UniRef90_Q8TGU5
39

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8TGU5

Checksumi: 333175655A8279D7

FASTA394,514
        10         20         30 
MKVLDDWFSR KFSKAVHGNN HGTISLSTLS YIRVHKLVK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again