Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q96B97 SH3 domain-containing kinase-binding protein 1 n=971 Tax=Gnathostomata TaxID=7776 RepID=SH3K1_HUMAN MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD CIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK ALQSK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 971  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96B97SH3K1_HUMANSH3 domain-containing kinase-binding protein 1Homo sapiens (Human)9606UniRef100_Q96B97
UniRef90_Q96B97
665Representative
Q925Q9SH3K1_RATSH3 domain-containing kinase-binding protein 1Rattus norvegicus (Rat)10116UniRef100_Q925Q9
UniRef90_Q925Q9
709
Q8R550SH3K1_MOUSESH3 domain-containing kinase-binding protein 1Mus musculus (Mouse)10090UniRef100_Q8R550
UniRef90_Q925Q9
709
Q5JPT6Q5JPT6_HUMANGIG10Homo sapiens (Human)9606UniRef100_Q96B97
UniRef90_Q96B97
665
H2PV30H2PV30_PONABSH3 domain containing kinase binding protein 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PV30
UniRef90_Q96B97
711
A0A2J8W436A0A2J8W436_PONABSH3KBP1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PV30
UniRef90_Q96B97
665
A0A2J8JF33A0A2J8JF33_PANTRUncharacterized protein (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_H2PV30
UniRef90_Q96B97
242
G3RV02G3RV02_GORGOSH3 domain containing kinase binding protein 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RV02
UniRef90_Q96B97
671
K7BQU9K7BQU9_PANTRSH3 domain containing kinase binding protein 1Pan troglodytes (Chimpanzee)9598UniRef100_K7BQU9
UniRef90_Q96B97
665
A0A2J8IKS9A0A2J8IKS9_PANTRSH3KBP1 isoform 2 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BQU9
UniRef90_Q96B97
330
A0A2K5M7F3A0A2K5M7F3_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M7F3
UniRef90_Q96B97
665
I2CTK2I2CTK2_MACMUSH3 domain-containing kinase-binding protein 1 isoform aMacaca mulatta (Rhesus macaque)9544UniRef100_I2CTK2
UniRef90_Q96B97
665
A0A2I3LWG4A0A2I3LWG4_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_I2CTK2
UniRef90_Q96B97
665
A0A2K5W718A0A2K5W718_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_I2CTK2
UniRef90_Q96B97
665
G7Q2C1G7Q2C1_MACFACbl-interacting protein of 85 kDa (Fragment)Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_I2CTK2
UniRef90_Q96B97
664
Q3TA88Q3TA88_MOUSEUncharacterized proteinMus musculus (Mouse)10090UniRef100_Q3TA88
UniRef90_Q96B97
665
Q8R550-2Isoform 2 of SH3K1_MOUSE2, Ruk-lMus musculus (Mouse)10090UniRef100_Q3TA88
UniRef90_Q96B97
665
B1AZ85B1AZ85_MOUSESH3 domain-containing kinase-binding protein 1 (Fragment)Mus musculus (Mouse)10090UniRef100_Q3TA88
UniRef90_Q96B97
208
A0A2K5QB23A0A2K5QB23_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5QB23
UniRef90_Q96B97
665
Q6IRL5Q6IRL5_RATSH3-domain kinase binding protein 1Rattus norvegicus (Rat)10116UniRef100_Q6IRL5
UniRef90_Q96B97
665
Q925Q9-2Isoform 2 of SH3K1_RAT2, Ruk-lRattus norvegicus (Rat)10116UniRef100_Q6IRL5
UniRef90_Q96B97
665
Q925Q9-7Isoform 7 of SH3K1_RAT7Rattus norvegicus (Rat)10116UniRef100_Q6IRL5
UniRef90_Q96B97
592
H9ETF7H9ETF7_MACMUSH3 domain-containing kinase-binding protein 1 isoform aMacaca mulatta (Rhesus macaque)9544UniRef100_H9ETF7
UniRef90_Q96B97
665
A0A2K6CWM0A0A2K6CWM0_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CWM0
UniRef90_Q96B97
665
A0A2K6PVD3A0A2K6PVD3_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVD3
UniRef90_Q96B97
665

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96B97

Checksumi: 3BD350FCDB14BD4C

FASTA66573,126
        10         20         30         40         50
MVEAIVEFDY QAQHDDELTI SVGEIITNIR KEDGGWWEGQ INGRRGLFPD
60 70 80 90 100
NFVREIKKEM KKDPLTNKAP EKPLHEVPSG NSLLSSETIL RTNKRGERRR
110 120 130 140 150
RRCQVAFSYL PQNDDELELK VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN
160 170 180 190 200
FIKELSGESD ELGISQDEQL SKSSLRETTG SESDGGDSSS TKSEGANGTV
210 220 230 240 250
ATAAIQPKKV KGVGFGDIFK DKPIKLRPRS IEVENDFLPV EKTIGKKLPA
260 270 280 290 300
TTATPDSSKT EMDSRTKSKD YCKVIFPYEA QNDDELTIKE GDIVTLINKD
310 320 330 340 350
CIDVGWWEGE LNGRRGVFPD NFVKLLPPDF EKEGNRPKKP PPPSAPVIKQ
360 370 380 390 400
GAGTTERKHE IKKIPPERPE MLPNRTEEKE RPEREPKLDL QKPSVPAIPP
410 420 430 440 450
KKPRPPKTNS LSRPGALPPR RPERPVGPLT HTRGDSPKID LAGSSLSGIL
460 470 480 490 500
DKDLSDRSND IDLEGFDSVV SSTEKLSHPT TSRPKATGRR PPSQSLTSSS
510 520 530 540 550
LSSPDIFDSP SPEEDKEEHI SLAHRGVDAS KKTSKTVTIS QVSDNKASLP
560 570 580 590 600
PKPGTMAAGG GGPAPLSSAA PSPLSSSLGT AGHRANSPSL FGTEGKPKME
610 620 630 640 650
PAASSQAAVE ELRTQVRELR SIIETMKDQQ KREIKQLLSE LDEEKKIRLR
660
LQMEVNDIKK ALQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again