Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q96EB6 NAD-dependent protein deacetylase sirtuin-1 n=260 Tax=Gnathostomata TaxID=7776 RepID=SIR1_HUMAN MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD GDDQEAINEAISVKQEVTDMNYPSNKS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 260  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96EB6SIR1_HUMANNAD-dependent protein deacetylase sirtuin-1Homo sapiens (Human)9606UniRef100_Q96EB6
UniRef90_Q96EB6
747Representative
A0A0G2JZ79SIR1_RATNAD-dependent protein deacetylase sirtuin-1Rattus norvegicus (Rat)10116UniRef100_A0A0G2JZ79
UniRef90_A0A0G2JZ79
555
A0A024QZQ1A0A024QZQ1_HUMANSirtuin (Silent mating type information regulation 2 homolog) 1 (S. cerevisiae), isoform CRA_aHomo sapiens (Human)9606UniRef100_Q96EB6
UniRef90_Q96EB6
747
E9PC49E9PC49_HUMANNAD-dependent protein deacetylase sirtuin-1Homo sapiens (Human)9606UniRef100_Q96EB6
UniRef90_Q96EB6
452
A8K128A8K128_HUMANcDNA FLJ76335, highly similar to Homo sapiens sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae), mRNAHomo sapiens (Human)9606UniRef100_Q96EB6
UniRef90_Q96EB6
555
H2Q1Z0H2Q1Z0_PANTRSIRT1 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_H2Q1Z0
UniRef90_Q96EB6
751
A0A2J8NV88A0A2J8NV88_PANTRSIRT1 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_H2Q1Z0
UniRef90_Q96EB6
452
G3R3W0G3R3W0_GORGOSirtuin 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R3W0
UniRef90_Q96EB6
751
A0A2J8WR65A0A2J8WR65_PONABSIRT1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WR65
UniRef90_Q96EB6
747
A0A2J8WR64A0A2J8WR64_PONABSIRT1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WR65
UniRef90_Q96EB6
452
H2NAR9H2NAR9_PONABSirtuin 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NAR9
UniRef90_Q96EB6
746
A0A2R8ZTS8A0A2R8ZTS8_PANPADeacetylase sirtuin-type domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZTS8
UniRef90_Q96EB6
693
A0A2R8ZQM7A0A2R8ZQM7_PANPADeacetylase sirtuin-type domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZTS8
UniRef90_Q96EB6
452
M3YKL1M3YKL1_MUSPFSirtuin 1Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3YKL1
UniRef90_M3YKL1
557
G1U0D5G1U0D5_RABITDeacetylase sirtuin-type domain-containing proteinOryctolagus cuniculus (Rabbit)9986UniRef100_G1U0D5
UniRef90_G1U0D5
748
A0A2Y9I0X8A0A2Y9I0X8_NEOSCNAD-dependent protein deacetylase sirtuin-1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9I0X8
UniRef90_A0A2U3VGM8
746
A0A2U3VGM8A0A2U3VGM8_ODORONAD-dependent protein deacetylase sirtuin-1 isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3VGM8
UniRef90_A0A2U3VGM8
740
A0A2U3VG90A0A2U3VG90_ODORONAD-dependent protein deacetylase sirtuin-1 isoform X2Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3VGM8
UniRef90_A0A2U3VGM8
453
A0A3Q7MGR2A0A3Q7MGR2_CALURNAD-dependent protein deacetylase sirtuin-1 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7MGR2
UniRef90_A0A2U3VGM8
740
A0A1U7TVQ2A0A1U7TVQ2_TARSYNAD-dependent protein deacetylase sirtuin-1 isoform X1Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TVQ2
UniRef90_A0A2U3VGM8
627
A0A3Q0E1V2A0A3Q0E1V2_TARSYNAD-dependent protein deacetylase sirtuin-1 isoform X2Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TVQ2
UniRef90_A0A2U3VGM8
451
A0A2U3XBX0A0A2U3XBX0_LEPWENAD-dependent protein deacetylase sirtuin-1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3XBX0
UniRef90_A0A2Y9J3X4
624
A0A2Y9J3X4A0A2Y9J3X4_ENHLUNAD-dependent protein deacetylase sirtuin-1 isoform X1Enhydra lutris kenyoni391180UniRef100_A0A2Y9J3X4
UniRef90_A0A2Y9J3X4
751
A0A4D9ERM2A0A4D9ERM2_9SAURMilk lysozymePlatysternon megacephalum (big-headed turtle)55544UniRef100_A0A4D9ERM2
UniRef90_K7FFK1
743
A0A452GP91A0A452GP91_9SAURDeacetylase sirtuin-type domain-containing proteinGopherus agassizii (Agassiz's desert tortoise)38772UniRef100_A0A452GP91
UniRef90_K7FFK1
742

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96EB6

Checksumi: 2D3BEA6D73DA229F

FASTA74781,681
        10         20         30         40         50
MADEAALALQ PGGSPSAAGA DREAASSPAG EPLRKRPRRD GPGLERSPGE
60 70 80 90 100
PGGAAPEREV PAAARGCPGA AAAALWREAE AEAAAAGGEQ EAQATAAAGE
110 120 130 140 150
GDNGPGLQGP SREPPLADNL YDEDDDDEGE EEEEAAAAAI GYRDNLLFGD
160 170 180 190 200
EIITNGFHSC ESDEEDRASH ASSSDWTPRP RIGPYTFVQQ HLMIGTDPRT
210 220 230 240 250
ILKDLLPETI PPPELDDMTL WQIVINILSE PPKRKKRKDI NTIEDAVKLL
260 270 280 290 300
QECKKIIVLT GAGVSVSCGI PDFRSRDGIY ARLAVDFPDL PDPQAMFDIE
310 320 330 340 350
YFRKDPRPFF KFAKEIYPGQ FQPSLCHKFI ALSDKEGKLL RNYTQNIDTL
360 370 380 390 400
EQVAGIQRII QCHGSFATAS CLICKYKVDC EAVRGDIFNQ VVPRCPRCPA
410 420 430 440 450
DEPLAIMKPE IVFFGENLPE QFHRAMKYDK DEVDLLIVIG SSLKVRPVAL
460 470 480 490 500
IPSSIPHEVP QILINREPLP HLHFDVELLG DCDVIINELC HRLGGEYAKL
510 520 530 540 550
CCNPVKLSEI TEKPPRTQKE LAYLSELPPT PLHVSEDSSS PERTSPPDSS
560 570 580 590 600
VIVTLLDQAA KSNDDLDVSE SKGCMEEKPQ EVQTSRNVES IAEQMENPDL
610 620 630 640 650
KNVGSSTGEK NERTSVAGTV RKCWPNRVAK EQISRRLDGN QYLFLPPNRY
660 670 680 690 700
IFHGAEVYSD SEDDVLSSSS CGSNSDSGTC QSPSLEEPME DESEIEEFYN
710 720 730 740
GLEDEPDVPE RAGGAGFGTD GDDQEAINEA ISVKQEVTDM NYPSNKS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again