Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q96EE3 Nucleoporin SEH1 n=337 Tax=Gnathostomata TaxID=7776 RepID=SEH1_HUMAN MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 337  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96EE3SEH1_HUMANNucleoporin SEH1Homo sapiens (Human)9606UniRef100_Q96EE3
UniRef90_Q96EE3
360Representative
Q8R2U0SEH1_MOUSENucleoporin SEH1Mus musculus (Mouse)10090UniRef100_Q8R2U0
UniRef90_Q96EE3
360
A7YY75SEH1_BOVINNucleoporin SEH1Bos taurus (Bovine)9913UniRef100_A7YY75
UniRef90_Q96EE3
360
Q5RAN6SEH1_PONABNucleoporin SEH1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RAN6
UniRef90_Q96EE3
360
Q6TGU2SEH1_DANRENucleoporin SEH1Danio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q6TGU2
UniRef90_Q6TGU2
364
Q6GNF1SEH1B_XENLANucleoporin SEH1-BXenopus laevis (African clawed frog)8355UniRef100_Q6GNF1
UniRef90_Q5U4Y8
360
Q5U4Y8SEH1_XENTRNucleoporin SEH1Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_Q5U4Y8
UniRef90_Q5U4Y8
360
Q4FZW5SEH1A_XENLANucleoporin SEH1-AXenopus laevis (African clawed frog)8355UniRef100_Q4FZW5
UniRef90_Q5U4Y8
360
F7CBH5F7CBH5_MONDOUncharacterized proteinMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_F7CBH5
UniRef90_Q96EE3
361
G1U3G7G1U3G7_RABITUncharacterized proteinOryctolagus cuniculus (Rabbit)9986UniRef100_G1U3G7
UniRef90_Q96EE3
361
A0A4X2LWK0A0A4X2LWK0_VOMURUncharacterized proteinVombatus ursinus (Common wombat)29139UniRef100_A0A4X2LWK0
UniRef90_Q96EE3
361
A0A2Y9GMX0A0A2Y9GMX0_NEOSCnucleoporin SEH1 isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9GMX0
UniRef90_Q96EE3
360
A0A3Q7NRK9A0A3Q7NRK9_CALURnucleoporin SEH1 isoform X1Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A2Y9GMX0
UniRef90_Q96EE3
360
A0A2U3WIA6A0A2U3WIA6_ODOROnucleoporin SEH1 isoform X2Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2Y9GMX0
UniRef90_Q96EE3
360
F6PHQ1F6PHQ1_HORSESEH1 like nucleoporinEquus caballus (Horse)9796UniRef100_F6PHQ1
UniRef90_Q96EE3
360
A0A4W2BST7A0A4W2BST7_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A7YY75
UniRef90_Q96EE3
360
A0A2U4A5P6A0A2U4A5P6_TURTRnucleoporin SEH1 isoform X1Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U4A5P6
UniRef90_Q96EE3
360
A0A384CZU0A0A384CZU0_URSMAnucleoporin SEH1 isoform X2Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384CZU0
UniRef90_Q96EE3
360
A0A3Q7UZ56A0A3Q7UZ56_URSARnucleoporin SEH1 isoform X2Ursus arctos horribilis116960UniRef100_A0A384CZU0
UniRef90_Q96EE3
360
A0A250YGD1A0A250YGD1_CASCNNucleoporin SEH1Castor canadensis (American beaver)51338UniRef100_A0A250YGD1
UniRef90_Q96EE3
360
A0A1U7TVL2A0A1U7TVL2_TARSYnucleoporin SEH1 isoform X2Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TVL2
UniRef90_Q96EE3
360
H2QEA7H2QEA7_PANTRSEH1 like nucleoporinPan troglodytes (Chimpanzee)9598UniRef100_H2QEA7
UniRef90_Q96EE3
360
A0A2R8ZD69A0A2R8ZD69_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_H2QEA7
UniRef90_Q96EE3
360
A0A1S3G3K5A0A1S3G3K5_DIPORnucleoporin SEH1 isoform X1Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3G3K5
UniRef90_Q96EE3
360
G3SY73G3SY73_LOXAFUncharacterized proteinLoxodonta africana (African elephant)9785UniRef100_G3SY73
UniRef90_Q96EE3
360

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96EE3

Checksumi: FB9ED2440C4EC9AB

FASTA36039,649
        10         20         30         40         50
MFVARSIAAD HKDLIHDVSF DFHGRRMATC SSDQSVKVWD KSESGDWHCT
60 70 80 90 100
ASWKTHSGSV WRVTWAHPEF GQVLASCSFD RTAAVWEEIV GESNDKLRGQ
110 120 130 140 150
SHWVKRTTLV DSRTSVTDVK FAPKHMGLML ATCSADGIVR IYEAPDVMNL
160 170 180 190 200
SQWSLQHEIS CKLSCSCISW NPSSSRAHSP MIAVGSDDSS PNAMAKVQIF
210 220 230 240 250
EYNENTRKYA KAETLMTVTD PVHDIAFAPN LGRSFHILAI ATKDVRIFTL
260 270 280 290 300
KPVRKELTSS GGPTKFEIHI VAQFDNHNSQ VWRVSWNITG TVLASSGDDG
310 320 330 340 350
CVRLWKANYM DNWKCTGILK GNGSPVNGSS QQGTSNPSLG STIPSLQNSL
360
NGSSAGRKHS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again