Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q96PK6 RNA-binding protein 14 n=274 RepID=RBM14_HUMAN MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ MHSGYQRRM

Members

List component clusters with 100% or 90% identity.
1 to 25 of 274  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96PK6RBM14_HUMANRNA-binding protein 14Homo sapiens (Human)9606UniRef100_Q96PK6
UniRef90_Q96PK6
669Representative
Q5RC41RBM14_PONABRNA-binding protein 14Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RC41
UniRef90_Q96PK6
669
Q8C2Q3RBM14_MOUSERNA-binding protein 14Mus musculus (Mouse)10090UniRef100_Q8C2Q3
UniRef90_Q96PK6
669
Q5EA36RBM14_BOVINRNA-binding protein 14Bos taurus (Bovine)9913UniRef100_Q5EA36
UniRef90_Q5EA36
669
A0A0S2Z4Z0A0A0S2Z4Z0_HUMANRNA binding motif protein 14 isoform 1 (Fragment)Homo sapiens (Human)9606UniRef100_Q96PK6
UniRef90_Q96PK6
669
G7NC47G7NC47_MACMURNA-binding motif protein 14Macaca mulatta (Rhesus macaque)9544UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2K6RMQ0A0A2K6RMQ0_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_Q96PK6
UniRef90_Q96PK6
669
H2NCQ6H2NCQ6_PONABRNA-binding protein 14Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2K5MKG5A0A2K5MKG5_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A096MNJ6A0A096MNJ6_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2K5XQR4A0A2K5XQR4_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_Q96PK6
UniRef90_Q96PK6
669
G3R212G3R212_GORGORNA binding motif protein 14Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2K5WC76A0A2K5WC76_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2K6MV28A0A2K6MV28_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A091DZW6A0A091DZW6_FUKDARNA-binding protein 14Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_Q96PK6
UniRef90_Q96PK6
669
A0A2I2Z1G0A0A2I2Z1G0_GORGORNA binding motif protein 14Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q96PK6
UniRef90_Q96PK6
551
A0A480ENR3A0A480ENR3_PIGRNA-binding protein 14 isoform 1Sus scrofa (Pig)9823UniRef100_A0A480ENR3
UniRef90_Q96PK6
727
A0A480XI37A0A480XI37_PIGRNA-binding protein 14 isoform 1Sus scrofa (Pig)9823UniRef100_A0A480XI37
UniRef90_Q96PK6
701
A0A061I8L8A0A061I8L8_CRIGRRNA-binding protein 14Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A061I8L8
UniRef90_Q96PK6
669
A0A2Y9DYZ5A0A2Y9DYZ5_TRIMARNA-binding protein 14 isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DYZ5
UniRef90_Q96PK6
669
A0A2Y9RF71A0A2Y9RF71_TRIMARNA-binding protein 14 isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DYZ5
UniRef90_Q96PK6
551
A0A2K5I1N3A0A2K5I1N3_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5I1N3
UniRef90_Q96PK6
669
A0A2Y9F6F0A0A2Y9F6F0_PHYMCRNA-binding protein 14 isoform X1Physeter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9F6F0
UniRef90_Q96PK6
669
A0A340XKQ6A0A340XKQ6_LIPVERNA-binding protein 14 isoform X1Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A2Y9F6F0
UniRef90_Q96PK6
669
A0A341BRR7A0A341BRR7_9CETARNA-binding protein 14 isoform X1Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A2Y9F6F0
UniRef90_Q96PK6
669

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96PK6

Checksumi: 565C5EF51B6881FD

FASTA66969,492
        10         20         30         40         50
MKIFVGNVDG ADTTPEELAA LFAPYGTVMS CAVMKQFAFV HMRENAGALR
60 70 80 90 100
AIEALHGHEL RPGRALVVEM SRPRPLNTWK IFVGNVSAAC TSQELRSLFE
110 120 130 140 150
RRGRVIECDV VKDYAFVHME KEADAKAAIA QLNGKEVKGK RINVELSTKG
160 170 180 190 200
QKKGPGLAVQ SGDKTKKPGA GDTAFPGTGG FSATFDYQQA FGNSTGGFDG
210 220 230 240 250
QARQPTPPFF GRDRSPLRRS PPRASYVAPL TAQPATYRAQ PSVSLGAAYR
260 270 280 290 300
AQPSASLGVG YRTQPMTAQA ASYRAQPSVS LGAPYRGQLA SPSSQSAAAS
310 320 330 340 350
SLGPYGGAQP SASALSSYGG QAAAASSLNS YGAQGSSLAS YGNQPSSYGA
360 370 380 390 400
QAASSYGVRA AASSYNTQGA ASSLGSYGAQ AASYGAQSAA SSLAYGAQAA
410 420 430 440 450
SYNAQPSASY NAQSAPYAAQ QAASYSSQPA AYVAQPATAA AYASQPAAYA
460 470 480 490 500
AQATTPMAGS YGAQPVVQTQ LNSYGAQASM GLSGSYGAQS AAAATGSYGA
510 520 530 540 550
AAAYGAQPSA TLAAPYRTQS SASLAASYAA QQHPQAAASY RGQPGNAYDG
560 570 580 590 600
AGQPSAAYLS MSQGAVANAN STPPPYERTR LSPPRASYDD PYKKAVAMSK
610 620 630 640 650
RYGSDRRLAE LSDYRRLSES QLSFRRSPTK SSLDYRRLPD AHSDYARYSG
660
SYNDYLRAAQ MHSGYQRRM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again