Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q96ST2 Protein IWS1 homolog n=206 Tax=Sarcopterygii TaxID=8287 RepID=IWS1_HUMAN MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSENETSDREDGL PKGHHVTDSENDEPLNLNASDSESEELHRQKDSDSESEERAEPPASDSENEDVNQHGSDS ESEETRKLPGSDSENEELLNGHASDSENEDVGKHPASDSEIEELQKSPASDSETEDALKP QISDSESEEPPRHQASDSENEEPPKPRMSDSESEELPKPQVSDSESEEPPRHQASDSENE ELPKPRISDSESEDPPRHQASDSENEELPKPRISDSESEDPPRNQASDSENEELPKPRVS DSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQNDSFHSDSHMDRKKF HSSDSEEEEHKKQKMDSDEDEKEGEEEKVAKRKAAVLSDSEDEEKASAKKSRVVSDADDS DSDAVSDKSGKREKTIASDSEEEAGKELSDKKNEEKDLFGSDSESGNEEENLIADIFGES GDEEEEEFTGFNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMS GKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKK QDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRA VMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNS TGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQAT SKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 206  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96ST2IWS1_HUMANProtein IWS1 homologHomo sapiens (Human)9606UniRef100_Q96ST2
UniRef90_Q96ST2
819Representative
Q3SWT4IWS1_RATProtein IWS1 homologRattus norvegicus (Rat)10116UniRef100_Q3SWT4
UniRef90_Q3SWT4
764
F6QCP5F6QCP5_CALJAInteracts with SUPT6H, CTD assembly factor 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6QCP5
UniRef90_Q96ST2
854
A0A096N4T5A0A096N4T5_PAPANInteracts with SUPT6H, CTD assembly factor 1Papio anubis (Olive baboon)9555UniRef100_A0A096N4T5
UniRef90_Q96ST2
824
G1S0X5G1S0X5_NOMLEInteracts with SUPT6H, CTD assembly factor 1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1S0X5
UniRef90_Q96ST2
819
H9ER08H9ER08_MACMUProtein IWS1 homologMacaca mulatta (Rhesus macaque)9544UniRef100_H9ER08
UniRef90_Q96ST2
819
A0A5K1VQ97A0A5K1VQ97_MACMUProtein IWS1 homologMacaca mulatta (Rhesus macaque)9544UniRef100_A0A5K1VQ97
UniRef90_Q96ST2
819
A0A2K6BMR6A0A2K6BMR6_MACNEInteracts with SUPT6H, CTD assembly factor 1Macaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A5K1VQ97
UniRef90_Q96ST2
819
U3DIT9U3DIT9_CALJAProtein IWS1 homologCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3DIT9
UniRef90_Q96ST2
819
A0A2K6NW24A0A2K6NW24_RHIROInteracts with SUPT6H, CTD assembly factor 1Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6NW24
UniRef90_Q96ST2
819
G7NB48G7NB48_MACMUProtein IWS1 homologMacaca mulatta (Rhesus macaque)9544UniRef100_G7NB48
UniRef90_Q96ST2
819
G7PLG6G7PLG6_MACFATFIIS N-terminal domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7NB48
UniRef90_Q96ST2
819
A0A2R9C5I5A0A2R9C5I5_PANPAInteracts with SUPT6H, CTD assembly factor 1Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9C5I5
UniRef90_Q96ST2
819
A0A2K5RTP2A0A2K5RTP2_CEBCAInteracts with SUPT6H, CTD assembly factor 1Cebus capucinus imitator1737458UniRef100_A0A2K5RTP2
UniRef90_Q96ST2
819
A0A2K5M1V0A0A2K5M1V0_CERATInteracts with SUPT6H, CTD assembly factor 1Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M1V0
UniRef90_Q96ST2
819
H2P7A2H2P7A2_PONABIWS1 isoform 6Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2P7A2
UniRef90_Q96ST2
819
A0A2K5UHB8A0A2K5UHB8_MACFAInteracts with SUPT6H, CTD assembly factor 1Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UHB8
UniRef90_Q96ST2
819
G3R4F3G3R4F3_GORGOInteracts with SUPT6H, CTD assembly factor 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3R4F3
UniRef90_Q96ST2
819
A0A2K6SS42A0A2K6SS42_SAIBBInteracts with SUPT6H, CTD assembly factor 1Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6SS42
UniRef90_Q96ST2
819
A0A2K6KTK0A0A2K6KTK0_RHIBEInteracts with SUPT6H, CTD assembly factor 1Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KTK0
UniRef90_Q96ST2
819
A0A2K5KBM4A0A2K5KBM4_COLAPInteracts with SUPT6H, CTD assembly factor 1Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K6KTK0
UniRef90_Q96ST2
819
H2QIN9H2QIN9_PANTRIWS1 homologPan troglodytes (Chimpanzee)9598UniRef100_H2QIN9
UniRef90_Q96ST2
819
A0A2K5Y7I6A0A2K5Y7I6_MANLEInteracts with SUPT6H, CTD assembly factor 1Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Y7I6
UniRef90_Q96ST2
817
F7H226F7H226_MACMUInteracts with SUPT6H, CTD assembly factor 1Macaca mulatta (Rhesus macaque)9544UniRef100_F7H226
UniRef90_Q96ST2
811
A0A2K5EL53A0A2K5EL53_AOTNAInteracts with SUPT6H, CTD assembly factor 1Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5EL53
UniRef90_Q96ST2
800

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96ST2

Checksumi: C9749A2C2DC05D72

FASTA81991,954
        10         20         30         40         50
MDSEYYSGDQ SDDGGATPVQ DERDSGSDGE DDVNEQHSGS DTGSVERHSE
60 70 80 90 100
NETSDREDGL PKGHHVTDSE NDEPLNLNAS DSESEELHRQ KDSDSESEER
110 120 130 140 150
AEPPASDSEN EDVNQHGSDS ESEETRKLPG SDSENEELLN GHASDSENED
160 170 180 190 200
VGKHPASDSE IEELQKSPAS DSETEDALKP QISDSESEEP PRHQASDSEN
210 220 230 240 250
EEPPKPRMSD SESEELPKPQ VSDSESEEPP RHQASDSENE ELPKPRISDS
260 270 280 290 300
ESEDPPRHQA SDSENEELPK PRISDSESED PPRNQASDSE NEELPKPRVS
310 320 330 340 350
DSESEGPQKG PASDSETEDA SRHKQKPESD DDSDRENKGE DTEMQNDSFH
360 370 380 390 400
SDSHMDRKKF HSSDSEEEEH KKQKMDSDED EKEGEEEKVA KRKAAVLSDS
410 420 430 440 450
EDEEKASAKK SRVVSDADDS DSDAVSDKSG KREKTIASDS EEEAGKELSD
460 470 480 490 500
KKNEEKDLFG SDSESGNEEE NLIADIFGES GDEEEEEFTG FNQEDLEEEK
510 520 530 540 550
GETQVKEAED SDSDDNIKRG KHMDFLSDFE MMLQRKKSMS GKRRRNRDGG
560 570 580 590 600
TFISDADDVV SAMIVKMNEA AEEDRQLNNQ KKPALKKLTL LPAVVMHLKK
610 620 630 640 650
QDLKETFIDS GVMSAIKEWL SPLPDRSLPA LKIREELLKI LQELPSVSQE
660 670 680 690 700
TLKHSGIGRA VMYLYKHPKE SRSNKDMAGK LINEWSRPIF GLTSNYKGMT
710 720 730 740 750
REEREQRDLE QMPQRRRMNS TGGQTPRRDL EKVLTGEEKA LRPGDPGFCA
760 770 780 790 800
RARVPMPSNK DYVVRPKWNV EMESSRFQAT SKKGISRLDK QMRKFTDIRK
810
KSRSAHAVKI SIEGNKMPL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again