Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q99623 Prohibitin-2 n=507 Tax=Eukaryota TaxID=2759 RepID=PHB2_HUMAN MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQ DTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSM YQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILD DVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGE ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 507  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q99623PHB2_HUMANProhibitin-2Homo sapiens (Human)9606UniRef100_Q99623
UniRef90_Q99623
299Representative
O35129PHB2_MOUSEProhibitin-2Mus musculus (Mouse)10090UniRef100_Q99623
UniRef90_Q99623
299
Q5ZMN3PHB2_CHICKProhibitin-2Gallus gallus (Chicken)9031UniRef100_Q5ZMN3
UniRef90_Q99623
301
Q2HJ97PHB2_BOVINProhibitin-2Bos taurus (Bovine)9913UniRef100_Q2HJ97
UniRef90_Q99623
299
Q5RB19PHB2_PONABProhibitin-2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RB19
UniRef90_Q99623
299
Q5XIH7PHB2_RATProhibitin-2Rattus norvegicus (Rat)10116UniRef100_Q5XIH7
UniRef90_Q99623
299
A0A2J8TBL3A0A2J8TBL3_PONABPHB2 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q99623
UniRef90_Q99623
299
H9FPI0H9FPI0_MACMUProhibitin-2 isoform 2Macaca mulatta (Rhesus macaque)9544UniRef100_Q99623
UniRef90_Q99623
299
K7CG54K7CG54_PANTRPHB2 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q99623
UniRef90_Q99623
299
U3BL34U3BL34_CALJAProhibitin-2 isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_Q99623
UniRef90_Q99623
299
A0A2K6NQ48A0A2K6NQ48_RHIROPHB domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_Q99623
UniRef90_Q99623
299
A0A2K5MXZ6A0A2K5MXZ6_CERATPHB domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q99623
UniRef90_Q99623
299
A0A2K5CZ94A0A2K5CZ94_AOTNAPHB domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_Q99623
UniRef90_Q99623
299
A0A2I3M437A0A2I3M437_PAPANPHB domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_Q99623
UniRef90_Q99623
299
A0A2R9BF37A0A2R9BF37_PANPAPHB domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q99623
UniRef90_Q99623
299
A0A2K5YI83A0A2K5YI83_MANLEPHB domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_Q99623
UniRef90_Q99623
299
G1QYW8G1QYW8_NOMLEPHB domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_Q99623
UniRef90_Q99623
299
G3QNS7G3QNS7_GORGOProhibitin 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q99623
UniRef90_Q99623
299
A0A2K5W040A0A2K5W040_MACFAPHB domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q99623
UniRef90_Q99623
299
A0A2K6N321A0A2K6N321_RHIBEPHB domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q99623
UniRef90_Q99623
299
A0A2K6AR19A0A2K6AR19_MACNEPHB domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_Q99623
UniRef90_Q99623
299
A0A2K6S102A0A2K6S102_SAIBBProhibitin 2Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_Q99623
UniRef90_Q99623
299
A0A2K5Q0P6A0A2K5Q0P6_CEBCAPHB domain-containing proteinCebus capucinus imitator1737458UniRef100_Q99623
UniRef90_Q99623
299
Q3V235Q3V235_MOUSEProhibitin 2Mus musculus (Mouse)10090UniRef100_Q99623
UniRef90_Q99623
299
H0W5T5H0W5T5_CAVPOPHB domain-containing proteinCavia porcellus (Guinea pig)10141UniRef100_Q99623
UniRef90_Q99623
299

Sequence

Representative sequenceiLengthMass (Da)Tools
Q99623

Checksumi: A887CC982BF85C80

FASTA29933,296
        10         20         30         40         50
MAQNLKDLAG RLPAGPRGMG TALKLLLGAG AVAYGVRESV FTVEGGHRAI
60 70 80 90 100
FFNRIGGVQQ DTILAEGLHF RIPWFQYPII YDIRARPRKI SSPTGSKDLQ
110 120 130 140 150
MVNISLRVLS RPNAQELPSM YQRLGLDYEE RVLPSIVNEV LKSVVAKFNA
160 170 180 190 200
SQLITQRAQV SLLIRRELTE RAKDFSLILD DVAITELSFS REYTAAVEAK
210 220 230 240 250
QVAQQEAQRA QFLVEKAKQE QRQKIVQAEG EAEAAKMLGE ALSKNPGYIK
260 270 280 290
LRKIRAAQNI SKTIATSQNR IYLTADNLVL NLQDESFTRG SDSLIKGKK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again