Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q99706 Killer cell immunoglobulin-like receptor 2DL4 n=317 Tax=Simiiformes TaxID=314293 RepID=KI2L4_HUMAN MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH LHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTY AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT ALSQTQLASSNVPAAGI

Members

List component clusters with 100% or 90% identity.
1 to 25 of 317  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q99706KI2L4_HUMANKiller cell immunoglobulin-like receptor 2DL4Homo sapiens (Human)9606UniRef100_Q99706
UniRef90_Q99706
377Representative
P43629KI3L1_HUMANKiller cell immunoglobulin-like receptor 3DL1Homo sapiens (Human)9606UniRef100_P43629
UniRef90_P43629
444
Q14943KI3S1_HUMANKiller cell immunoglobulin-like receptor 3DS1Homo sapiens (Human)9606UniRef100_Q14943
UniRef90_P43629
382
E7EST5E7EST5_HUMANKiller cell immunoglobulin-like receptor 2DL4Homo sapiens (Human)9606UniRef100_Q99706
UniRef90_Q99706
416
A0A0C4ZR19A0A0C4ZR19_HUMANKiller cell immunoglobulin-like receptor two domains long cytoplasmic tail 4Homo sapiens (Human)9606UniRef100_Q99706
UniRef90_Q99706
377
C3VNC8C3VNC8_HUMANKIR2DL4 variant 4 (Fragment)Homo sapiens (Human)9606UniRef100_Q99706
UniRef90_Q99706
96
A0A0G2JN69A0A0G2JN69_HUMANKiller cell immunoglobulin-like receptor 2DL4Homo sapiens (Human)9606UniRef100_A0A0G2JN69
UniRef90_Q99706
416
A0A0C4ZMX4A0A0C4ZMX4_HUMANKiller cell immunoglobulin-like receptor two domains long cytoplasmic tail 4Homo sapiens (Human)9606UniRef100_A0A0G2JN69
UniRef90_Q99706
377
A0A2I3TBY4A0A2I3TBY4_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TBY4
UniRef90_Q99706
416
H2QH45H2QH45_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TBY4
UniRef90_Q99706
375
A0A2J8IX80A0A2J8IX80_PANTRKIR2DL4 isoform 7Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TBY4
UniRef90_Q99706
377
A0A0G2JPG6A0A0G2JPG6_HUMANKiller cell immunoglobulin-like receptor 2DL4Homo sapiens (Human)9606UniRef100_A0A0G2JPG6
UniRef90_Q99706
416
Q86U48Q86U48_HUMANKIR2DL4Homo sapiens (Human)9606UniRef100_A0A0G2JPG6
UniRef90_Q99706
377
C3VNC0C3VNC0_HUMANKIR2DL4 variant 1 (Fragment)Homo sapiens (Human)9606UniRef100_A0A0G2JPG6
UniRef90_Q99706
137
Q86VF1Q86VF1_HUMANNatural killer cell recpetor (Fragment)Homo sapiens (Human)9606UniRef100_A0A0G2JPG6
UniRef90_Q99706
352
Q96L47Q96L47_HUMANNK cell receptor (Fragment)Homo sapiens (Human)9606UniRef100_A0A0G2JPG6
UniRef90_Q99706
144
A0A0G2JMD1A0A0G2JMD1_HUMANKIR2DL4 proteinHomo sapiens (Human)9606UniRef100_A0A0G2JMD1
UniRef90_Q99706
399
A0A0G2JNI1A0A0G2JNI1_HUMANKiller cell immunoglobulin-like receptor 2DL4Homo sapiens (Human)9606UniRef100_A0A0G2JNI1
UniRef90_Q99706
399
A0A1W2PQV0A0A1W2PQV0_HUMANKiller cell immunoglobulin-like receptor 2DL4 (Fragment)Homo sapiens (Human)9606UniRef100_A0A1W2PQV0
UniRef90_Q99706
398
A8MT18A8MT18_HUMANKiller cell immunoglobulin-like receptor 2DL4 (Fragment)Homo sapiens (Human)9606UniRef100_A8MT18
UniRef90_Q99706
398
A0A2I3S7E8A0A2I3S7E8_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3S7E8
UniRef90_Q99706
391
G3RR32G3RR32_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RR32
UniRef90_Q99706
382
K7QUT1K7QUT1_HUMANKIR2DL4Homo sapiens (Human)9606UniRef100_K7QUT1
UniRef90_Q99706
377
Q32WD9Q32WD9_HUMANNatural killer cell inhibitory receptorHomo sapiens (Human)9606UniRef100_K7QUT1
UniRef90_Q99706
375
A7YL15A7YL15_HUMANKIR2DL4 (Fragment)Homo sapiens (Human)9606UniRef100_K7QUT1
UniRef90_Q99706
367

Sequence

Representative sequenceiLengthMass (Da)Tools
Q99706

Checksumi: 888B3297332D6C59

FASTA37741,487
        10         20         30         40         50
MSMSPTVIIL ACLGFFLDQS VWAHVGGQDK PFCSAWPSAV VPQGGHVTLR
60 70 80 90 100
CHYRRGFNIF TLYKKDGVPV PELYNRIFWN SFLISPVTPA HAGTYRCRGF
110 120 130 140 150
HPHSPTEWSA PSNPLVIMVT GLYEKPSLTA RPGPTVRAGE NVTLSCSSQS
160 170 180 190 200
SFDIYHLSRE GEAHELRLPA VPSINGTFQA DFPLGPATHG ETYRCFGSFH
210 220 230 240 250
GSPYEWSDPS DPLPVSVTGN PSSSWPSPTE PSFKTGIARH LHAVIRYSVA
260 270 280 290 300
IILFTILPFF LLHRWCSKKK DAAVMNQEPA GHRTVNREDS DEQDPQEVTY
310 320 330 340 350
AQLDHCIFTQ RKITGPSQRS KRPSTDTSVC IELPNAEPRA LSPAHEHHSQ
360 370
ALMGSSRETT ALSQTQLASS NVPAAGI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again