Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9BV40 Vesicle-associated membrane protein 8 n=89 Tax=Tetrapoda TaxID=32523 RepID=VAMP8_HUMAN MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 89  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9BV40VAMP8_HUMANVesicle-associated membrane protein 8Homo sapiens (Human)9606UniRef100_Q9BV40
UniRef90_Q9BV40
100Representative
Q5REQ5VAMP8_PONABVesicle-associated membrane protein 8Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q9BV40
UniRef90_Q9BV40
100
Q3T0Y8VAMP8_BOVINVesicle-associated membrane protein 8Bos taurus (Bovine)9913UniRef100_Q3T0Y8
UniRef90_Q9BV40
100
H2QI95H2QI95_PANTRVAMP8 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_Q9BV40
UniRef90_Q9BV40
100
F6ZVQ1F6ZVQ1_MACMUVesicle-associated membrane protein 8Macaca mulatta (Rhesus macaque)9544UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K6QMY6A0A2K6QMY6_RHIROV-SNARE coiled-coil homology domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2J8RP75A0A2J8RP75_PONABVAMP8 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K5LC37A0A2K5LC37_CERATV-SNARE coiled-coil homology domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2I3MIA7A0A2I3MIA7_PAPANV-SNARE coiled-coil homology domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2R9AJY4A0A2R9AJY4_PANPAV-SNARE coiled-coil homology domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A0D9RUG9A0A0D9RUG9_CHLSBV-SNARE coiled-coil homology domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_Q9BV40
UniRef90_Q9BV40
100
G1QN71G1QN71_NOMLEV-SNARE coiled-coil homology domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_Q9BV40
UniRef90_Q9BV40
100
G3QQI0G3QQI0_GORGOV-SNARE coiled-coil homology domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K5WGM6A0A2K5WGM6_MACFAV-SNARE coiled-coil homology domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K6L0V6A0A2K6L0V6_RHIBEV-SNARE coiled-coil homology domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K6CPC0A0A2K6CPC0_MACNEV-SNARE coiled-coil homology domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K6TB52A0A2K6TB52_SAIBBVesicle associated membrane protein 8Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K5KDS9A0A2K5KDS9_COLAPV-SNARE coiled-coil homology domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_Q9BV40
UniRef90_Q9BV40
100
A0A2K5QTY2A0A2K5QTY2_CEBCAV-SNARE coiled-coil homology domain-containing proteinCebus capucinus imitator1737458UniRef100_Q9BV40
UniRef90_Q9BV40
100
L8IVX7L8IVX7_9CETAVesicle-associated membrane protein 8 (Fragment)Bos mutus (wild yak)72004UniRef100_L8IVX7
UniRef90_Q9BV40
111
A0A3Q7NS06A0A3Q7NS06_CALURvesicle-associated membrane protein 8Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7NS06
UniRef90_Q9BV40
101
A0A2Y9JHV4A0A2Y9JHV4_ENHLUvesicle-associated membrane protein 8Enhydra lutris kenyoni391180UniRef100_A0A2Y9JHV4
UniRef90_Q9BV40
101
G3SNQ2G3SNQ2_LOXAFVesicle associated membrane protein 8Loxodonta africana (African elephant)9785UniRef100_G3SNQ2
UniRef90_Q9BV40
101
A0A3Q7UMP5A0A3Q7UMP5_URSARvesicle-associated membrane protein 8 isoform X2Ursus arctos horribilis116960UniRef100_A0A3Q7UMP5
UniRef90_Q9BV40
101
A0A452SU52A0A452SU52_URSAMVesicle associated membrane protein 8Ursus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A3Q7UMP5
UniRef90_Q9BV40
101

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9BV40

Checksumi: 018B986442BBD9B6

FASTA10011,438
        10         20         30         40         50
MEEASEGGGN DRVRNLQSEV EGVKNIMTQN VERILARGEN LEHLRNKTED
60 70 80 90 100
LEATSEHFKT TSQKVARKFW WKNVKMIVLI CVIVFIIILF IVLFATGAFS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again