Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9BYL1 Sterile alpha motif domain-containing protein 10 n=64 Tax=Amniota TaxID=32524 RepID=SAM10_HUMAN MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPG TSLTWHDSRSQRAASSRPIKLLQQPGTDTPQGRLYSDHYGLYHTSPSLGGLTRPVVLWSQ QDVCKWLKKHCPHNYLVYVEAFSQHAITGRALLRLNAEKLQRMGLAQEAQRQEVLQQVLR LQVREEGRSLQLLSQASFGKMS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 64  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9BYL1SAM10_HUMANSterile alpha motif domain-containing protein 10Homo sapiens (Human)9606UniRef100_Q9BYL1
UniRef90_Q9BYL1
202Representative
H2QKT8H2QKT8_PANTRSAMD10 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q9BYL1
UniRef90_Q9BYL1
202
A0A2R9AM22A0A2R9AM22_PANPASAM domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q9BYL1
UniRef90_Q9BYL1
202
H2P2N6H2P2N6_PONABSAM domain-containing proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2P2N6
UniRef90_Q9BYL1
202
A0A287BPG0A0A287BPG0_PIGSAM domain-containing proteinSus scrofa (Pig)9823UniRef100_A0A287BPG0
UniRef90_Q9BYL1
202
A0A4X1TFW8A0A4X1TFW8_PIGSAM domain-containing proteinSus scrofa (Pig)9823UniRef100_A0A287BPG0
UniRef90_Q9BYL1
202
A0A2J8R2R3A0A2J8R2R3_PONABSAMD10 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8R2R3
UniRef90_Q9BYL1
202
A0A0D9RVW6A0A0D9RVW6_CHLSBSAM domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RVW6
UniRef90_Q9BYL1
202
E2REG9E2REG9_CANLFSterile alpha motif domain containing 10Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_E2REG9
UniRef90_Q9BYL1
202
G1RGT5G1RGT5_NOMLESAM domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1RGT5
UniRef90_Q9BYL1
202
Q5JWV3Q5JWV3_HUMANSterile alpha motif domain-containing protein 10 (Fragment)Homo sapiens (Human)9606UniRef100_Q5JWV3
UniRef90_Q9BYL1
106
A0A2J8KNB6A0A2J8KNB6_PANTRSAMD10 isoform 4 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8KNB6
UniRef90_Q9BYL1
106
Q05CZ7Q05CZ7_MOUSESamd10 protein (Fragment)Mus musculus (Mouse)10090UniRef100_Q05CZ7
UniRef90_Q05CZ7
247
A0A3L7HHT8A0A3L7HHT8_CRIGRSAMD10Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A3L7HHT8
UniRef90_A0A3L7HHT8
251
A0A3Q7TZY7A0A3Q7TZY7_VULVUsterile alpha motif domain-containing protein 10-like isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7TZY7
UniRef90_A0A3Q7TZY7
250
A0A3Q7UCH2A0A3Q7UCH2_VULVUsterile alpha motif domain-containing protein 10-like isoform X2Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7UCH2
UniRef90_A0A3Q7TZY7
250
A0A2U3YJA3A0A2U3YJA3_LEPWEsterile alpha motif domain-containing protein 10Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3YJA3
UniRef90_A0A2U3YJA3
202
A0A2Y9G3Q3A0A2Y9G3Q3_NEOSCsterile alpha motif domain-containing protein 10Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2U3YJA3
UniRef90_A0A2U3YJA3
202
A0A2K5M4F7A0A2K5M4F7_CERATSAM domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M4F7
UniRef90_A0A2K5M4F7
203
A0A2K5M4F1A0A2K5M4F1_CERATSAM domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M4F1
UniRef90_A0A2K5M4F7
199
A0A2K6SZV1A0A2K6SZV1_SAIBBSterile alpha motif domain containing 10Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6SZV1
UniRef90_A0A2K5M4F7
199
G3QM73G3QM73_GORGOSterile alpha motif domain containing 10Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QM73
UniRef90_A0A2K5M4F7
199
H9FA39H9FA39_MACMUSterile alpha motif domain-containing protein 10 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_H9FA39
UniRef90_H9FA39
113
A0A0P6J3F4A0A0P6J3F4_HETGASterile alpha motif domain-containing protein 10Heterocephalus glaber (Naked mole rat)10181UniRef100_A0A0P6J3F4
UniRef90_A0A287DFX8
202
A0A091DFT8A0A091DFT8_FUKDASterile alpha motif domain-containing protein 10Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_A0A091DFT8
UniRef90_A0A287DFX8
237

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9BYL1

Checksumi: DF2678F090A3E946

FASTA20222,770
        10         20         30         40         50
MFTELRSKLS PPRGRAGAVR AGFGERRDVD ATAHFSFCRT LLEHTVSAES
60 70 80 90 100
IPCHLPRTPG TSLTWHDSRS QRAASSRPIK LLQQPGTDTP QGRLYSDHYG
110 120 130 140 150
LYHTSPSLGG LTRPVVLWSQ QDVCKWLKKH CPHNYLVYVE AFSQHAITGR
160 170 180 190 200
ALLRLNAEKL QRMGLAQEAQ RQEVLQQVLR LQVREEGRSL QLLSQASFGK

MS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again