Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9CE47 50S ribosomal protein L1 n=758 RepID=RL1_LACLA MAKKSKALRAAIEKIDATKLYSVEEAVALAKETSFAKFDATVEVAYNLNIDVKKSDQQIR GAMVLPNGTGKTARVLVFAKGAKAEEATAAGADFVGSDELVAKINGGWLDFDVVIATPDM MAVVGRLGRVLGPRNLMPNPKTGTVTMDVTKAVEESKAGKVNYRADKAGNVHVPIGKVSF DTEKLVENFKALNSVIAAAKPAASKGAYITNLSVTTTMGPGVKVDSASF

Members

List component clusters with 100% or 90% identity.
1 to 25 of 758  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9CE47RL1_LACLA50S ribosomal protein L1Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)272623UniRef100_Q9CE47
UniRef90_Q9CE47
229Representative
A2RNF3RL1_LACLM50S ribosomal protein L1Lactococcus lactis subsp. cremoris (strain MG1363)416870UniRef100_A2RNF3
UniRef90_Q9CE47
229
Q02WD3RL1_LACLS50S ribosomal protein L1Lactococcus lactis subsp. cremoris (strain SK11)272622UniRef100_A2RNF3
UniRef90_Q9CE47
229
B1VEQ9RL1_CORU750S ribosomal protein L1Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)504474UniRef100_B1VEQ9
UniRef90_B1VEQ9
238
A4J100RL1_DESRM50S ribosomal protein L1Desulfotomaculum reducens (strain MI-1)349161UniRef100_A4J100
UniRef90_A4J100
229
Q0AUG8RL1_SYNWW50S ribosomal protein L1Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)335541UniRef100_Q0AUG8
UniRef90_Q0AUG8
233
A8LC67RL1_FRASN50S ribosomal protein L1Frankia sp. (strain EAN1pec)298653UniRef100_A8LC67
UniRef90_A8LC67
237
Q5FM22RL1_LACAC50S ribosomal protein L1Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)272621UniRef100_Q5FM22
UniRef90_Q5FM22
230
A8YTE3RL1_LACH450S ribosomal protein L1Lactobacillus helveticus (strain DPC 4571)405566UniRef100_A8YTE3
UniRef90_Q5FM22
230
A4VW08RL1_STRSY50S ribosomal protein L1Streptococcus suis (strain 05ZYH33)391295UniRef100_A4VW08
UniRef90_A4VW08
229
A4W2B6RL1_STRS250S ribosomal protein L1Streptococcus suis (strain 98HAH33)391296UniRef100_A4W2B6
UniRef90_A4VW08
229
A0A089XMN1A0A089XMN1_9LACT50S ribosomal protein L1Lactococcus lactis1358UniRef100_Q9CE47
UniRef90_Q9CE47
229
A0A0A7T2D0A0A0A7T2D0_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis (Streptococcus lactis)1360UniRef100_Q9CE47
UniRef90_Q9CE47
229
A0A199YRK9A0A199YRK9_9LACT50S ribosomal protein L1Lactococcus lactis RTB0181408188UniRef100_Q9CE47
UniRef90_Q9CE47
229
D2BM49D2BM49_LACLK50S ribosomal protein L1Lactococcus lactis subsp. lactis (strain KF147)684738UniRef100_Q9CE47
UniRef90_Q9CE47
229
S6EVJ6S6EVJ6_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis A121137134UniRef100_Q9CE47
UniRef90_Q9CE47
229
H5T1M2H5T1M2_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis IO-11046624UniRef100_Q9CE47
UniRef90_Q9CE47
229
U6EN29U6EN29_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis Dephy 11390360UniRef100_Q9CE47
UniRef90_Q9CE47
229
G6FAA7G6FAA7_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis CNCM I-16311042402UniRef100_Q9CE47
UniRef90_Q9CE47
229
A0A3B0GL38A0A3B0GL38_LACLL50S ribosomal protein L1Lactococcus lactis subsp. lactis bv. diacetylactis44688UniRef100_Q9CE47
UniRef90_Q9CE47
229
A0A514Z5R7A0A514Z5R7_9LACT50S ribosomal protein L1Lactococcus sp. KACC 193202592653UniRef100_A0A514Z5R7
UniRef90_Q9CE47
229
A0A552XPK4A0A552XPK4_9LACT50S ribosomal protein L1Lactococcus lactis1358UniRef100_A2RNF3
UniRef90_Q9CE47
229
T0S5K7T0S5K7_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN61234876UniRef100_A2RNF3
UniRef90_Q9CE47
229
A0A0M2ZPA6A0A0M2ZPA6_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris (Streptococcus cremoris)1359UniRef100_A2RNF3
UniRef90_Q9CE47
229
T0UY81T0UY81_LACLC50S ribosomal protein L1Lactococcus lactis subsp. cremoris TIFN11234871UniRef100_A2RNF3
UniRef90_Q9CE47
229

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9CE47

Checksumi: 115E6C463C1B2C78

FASTA22924,050
        10         20         30         40         50
MAKKSKALRA AIEKIDATKL YSVEEAVALA KETSFAKFDA TVEVAYNLNI
60 70 80 90 100
DVKKSDQQIR GAMVLPNGTG KTARVLVFAK GAKAEEATAA GADFVGSDEL
110 120 130 140 150
VAKINGGWLD FDVVIATPDM MAVVGRLGRV LGPRNLMPNP KTGTVTMDVT
160 170 180 190 200
KAVEESKAGK VNYRADKAGN VHVPIGKVSF DTEKLVENFK ALNSVIAAAK
210 220
PAASKGAYIT NLSVTTTMGP GVKVDSASF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again