Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9CPY3 Sororin n=27 Tax=Boreoeutheria TaxID=1437010 RepID=CDCA5_MOUSE MAERRTRSGGAAQRSGPRTSLTKPSKSSKRKSGSDLPNSFSEIWPRTTPAVPVRKAIVLK KIVAHAVEVPDVHTVRRSPRISFILEKENNPPLKVPTKEDLFKTCSVPGTPSSTPVLYTQ NVEPDSGEAELDSRDLEMSQKVRRSYSRLQSLGCASTSTPGRRSFFGFEGPDDLPGVSPV VCSKLIETPKVPAKDLVPARTKDLVPDSTKDLVPARTLPGISPPVVKEKRKKKVPEILKS ELDKWAVAMNAEFEAAEQFELLIE

Members

List component clusters with 100% or 90% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9CPY3CDCA5_MOUSESororinMus musculus (Mouse)10090UniRef100_Q9CPY3
UniRef90_Q9CPY3
264Representative
Q9CPY3-2Isoform 2 of CDCA5_MOUSE2Mus musculus (Mouse)10090UniRef100_Q9CPY3
UniRef90_Q9CPY3
127
A0A2K5D9B2A0A2K5D9B2_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D9B2
UniRef90_A0A2K6TDY2
279
A0A2K6TDY2A0A2K6TDY2_SAIBBCell division cycle associated 5Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6TDY2
UniRef90_A0A2K6TDY2
252
A0A2K5PGT3A0A2K5PGT3_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5PGT3
UniRef90_A0A2K6TDY2
252
E2RF84E2RF84_CANLFCell division cycle associated 5Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_E2RF84
UniRef90_E2RF84
268
A0A2K6FE66A0A2K6FE66_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FE66
UniRef90_A0A2K6FE66
274
A0A2K6FE70A0A2K6FE70_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FE70
UniRef90_A0A2K6FE66
251
UPI000A31740AsororinMus caroli (Ryukyu mouse) (Ricefield mouse)10089UniRef100_UPI000A31740A
UniRef90_Q9CPY3
256
UPI00109F9190sororinGrammomys surdaster491861UniRef100_UPI00109F9190
UniRef90_Q9CPY3
248
UPI000A308E45sororinMus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_UPI000A308E45
UniRef90_Q9CPY3
247
UPI00083FBF2Asororin isoform X1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI00083FBF2A
UniRef90_A0A2K6TDY2
278
UPI000939151Csororin isoform X1Hipposideros armiger (great roundleaf bat)186990UniRef100_UPI000939151C
UniRef90_UPI00093AD560
250
UPI00093AD560sororin isoform X2Hipposideros armiger (great roundleaf bat)186990UniRef100_UPI00093AD560
UniRef90_UPI00093AD560
276
UPI0005FBBFACsororin isoform X1Ovis aries (Sheep)9940UniRef100_UPI0005FBBFAC
UniRef90_UPI0005FBBFAC
279
UPI0003AF4C7Dsororin isoform X1Capra hircus (Goat)9925UniRef100_UPI0003AF4C7D
UniRef90_UPI0005FBBFAC
279
UPI000A1BC3DEsororin isoform X4Odocoileus virginianus texanus9880UniRef100_UPI000A1BC3DE
UniRef90_UPI0005FBBFAC
278
UPI0003AFB55Csororin isoform X2Capra hircus (Goat)9925UniRef100_UPI0003AFB55C
UniRef90_UPI0005FBBFAC
253
UPI000A1B8CFCsororin isoform X5Odocoileus virginianus texanus9880UniRef100_UPI000A1B8CFC
UniRef90_UPI0005FBBFAC
253
UPI0005FAF57Fsororin isoform X2Ovis aries (Sheep)9940UniRef100_UPI0005FAF57F
UniRef90_UPI0005FBBFAC
253
UPI0007A6BA98sororin isoform X2Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis)291302UniRef100_UPI0007A6BA98
UniRef90_UPI0007A7122F
268
UPI0007A7122Fsororin isoform X1Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis)291302UniRef100_UPI0007A7122F
UniRef90_UPI0007A7122F
274
UPI0007A6C402sororin isoform X3Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis)291302UniRef100_UPI0007A6C402
UniRef90_UPI0007A7122F
258
UPI0007A722CEsororin isoform X4Miniopterus natalensis (Natal long-fingered bat) (Miniopterus schreibersii natalensis)291302UniRef100_UPI0007A722CE
UniRef90_UPI0007A7122F
252
UPI0007EE8500sororin isoform X6Oryctolagus cuniculus (Rabbit)9986UniRef100_UPI0007EE8500
UniRef90_UPI0007EE8500
277

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9CPY3

Checksumi: E8543BBE3593B212

FASTA26428,991
        10         20         30         40         50
MAERRTRSGG AAQRSGPRTS LTKPSKSSKR KSGSDLPNSF SEIWPRTTPA
60 70 80 90 100
VPVRKAIVLK KIVAHAVEVP DVHTVRRSPR ISFILEKENN PPLKVPTKED
110 120 130 140 150
LFKTCSVPGT PSSTPVLYTQ NVEPDSGEAE LDSRDLEMSQ KVRRSYSRLQ
160 170 180 190 200
SLGCASTSTP GRRSFFGFEG PDDLPGVSPV VCSKLIETPK VPAKDLVPAR
210 220 230 240 250
TKDLVPDSTK DLVPARTLPG ISPPVVKEKR KKKVPEILKS ELDKWAVAMN
260
AEFEAAEQFE LLIE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again