Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9CUU3 Synaptonemal complex protein 2 n=315 Tax=Eutheria TaxID=9347 RepID=SYCP2_MOUSE MPVRPDLQQLEKCIDDALRKNDFKPLLALLQIDICEDVKIKCSKQFLRKLDDLICRELNK KDIQTVSSILISIGRCSKNIFILGQAGLQTMIKQGLVQKMVSWFENSKEIILNQQQSKDE AVMNMIEDLFDLLMVIYDISDEGKNQVLESFIPQICALVIDSRVNFCIQQEALKKMNLML DRIPQDANKILSNQEMLTLMSNMGERILDVGDYELQVGIVEALCRMTTEKRRQELAYEWF SMDFIANAFKEIKDCEFETDCRIFLNLVNGILGDKRRVYTFPCLSAFLGKYELQIPSDEK LEEFWIDFNLGSHTLSFYIAGDEEDHQWEAVTVPEEKVQMYNIEVRESKKLLTLTLKNIV KISKKEGKELLFYFDESLEITNVTKKVFGGNKYKEFTRKQGISVAKTSIHVLFDASGSQI LVPESQPSPVKENLIHLKEKSDIQKKLVNPLELGNSSSQDEITTPSRKKMSEASMIVPDT DRYTVRSPILLINTSTPRRSREPLQAINSVEKAVSKTSESGMDYAASPKSRQSDGRKRWN NRANHNKTTAVIQNKQYEDNESPDQNFNEIEDTLSNVSSAVGKVDKPVLPGVLDISKNTT HSRWACWTPVTTIKLCNNQRSRALPGDTCTQDTGVNKKCTKQKSVSDDDSEETQKGKYSK DVIKCNKSDEAEFCERNIQEQNHPKYSQKKNTANAKKSDWHIESETTYKSVLLNKTTEES LIYKKTCVLSKDVNTTICDKSPSRKSKRNHTKSRKELMSELTSCELEEIPVRENSKGKRF TGASESLINQISRRYNPSDSMMSTRKLKEPQDGSGFSKKPDLQFNKVQRKSYRKLKATVV NVTSECPLDDVYNFSLNGADEPVIKLGIQEFQATTREASMDNSLKLVKNHDEHDPFLKTK DKRMLSYEKKTLLSDTETECGCDDSKTDISWLKEPKTKRLMDYSRNKNTTKYKSRKSRSS MEKGQPRPTMVLNKNSMKNDYEVVVDGRTRLPRRATKTKKNYKDLSTSESESESEKECSY LFKDKLPTKEETIHSRAQTKKLPEKQQKVFNSEALKGQPSEEQKNSSRLREGREDSLCLS SASVSRSSSSVEVMRCTEKITERDFTQDYDYITKSLSPYPKAPSPEFLNGNNSVVGRGQS PRISETSAMCVRKSYSPASGPPFSPRHTPTKNNSVVNMKKANSVINNQRTQHCNSYSDVS SNSSEKLYMEPESPESCDNHMQNKREGNHAASPLSLSSEKIEKMWFDMPSENTHVSGPSQ RGSKRRMYLEDDELSNSNEAEVEEAEEREHLLSKKRCQWENSDQHTFKTSLSTPDFSVPK DWQQELQGAGMFYDNISSDYKRKTDSQHKIMDDFTTKTLKLTQQHLMAMTSQAQGRRDEN VEKFQVTLLDELEKVEKDSQTLRDLEKELVDIEEKLVQKMRAYHRCERERFRVLKTSLDK SFLVYNSVYEESVFTSEMCLMKANMKMLQDKLLKEMHEEEVLNIRRGLQSLFKAHEGNDA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 315  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9CUU3SYCP2_MOUSESynaptonemal complex protein 2Mus musculus (Mouse)10090UniRef100_Q9CUU3
UniRef90_Q9CUU3
1,500Representative
O70608SYCP2_RATSynaptonemal complex protein 2Rattus norvegicus (Rat)10116UniRef100_O70608
UniRef90_O70608
1,505
Q9BX26SYCP2_HUMANSynaptonemal complex protein 2Homo sapiens (Human)9606UniRef100_Q9BX26
UniRef90_Q9BX26
1,530
Q8CDQ4Q8CDQ4_MOUSEUncharacterized proteinMus musculus (Mouse)10090UniRef100_Q9CUU3
UniRef90_Q9CUU3
621
A2AJW3A2AJW3_MOUSESynaptonemal complex protein 2 (Fragment)Mus musculus (Mouse)10090UniRef100_Q9CUU3
UniRef90_Q9CUU3
185
A0A091EP65A0A091EP65_FUKDASynaptonemal complex protein 2Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_A0A091EP65
UniRef90_A0A091EP65
1,533
F1RJ15F1RJ15_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_F1RJ15
UniRef90_F1RJ15
1,472
A5GFP3A5GFP3_PIGSynaptonemal complex protein 2 (Fragment)Sus scrofa (Pig)9823UniRef100_F1RJ15
UniRef90_F1RJ15
279
A0A4X1UWT7A0A4X1UWT7_PIGSynaptonemal complex protein 2Sus scrofa (Pig)9823UniRef100_A0A4X1UWT7
UniRef90_F1RJ15
1,453
K7GKC1K7GKC1_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_K7GKC1
UniRef90_F1RJ15
1,408
A0A287BPD4A0A287BPD4_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A287BPD4
UniRef90_F1RJ15
1,347
A0A4X1UT72A0A4X1UT72_PIGSynaptonemal complex protein 2Sus scrofa (Pig)9823UniRef100_A0A4X1UT72
UniRef90_F1RJ15
1,330
A0A4X1UY12A0A4X1UY12_PIGSynaptonemal complex protein 2Sus scrofa (Pig)9823UniRef100_A0A4X1UY12
UniRef90_F1RJ15
1,308
A0A480E4X2A0A480E4X2_PIGSynaptonemal complex protein 2 isoform X5Sus scrofa (Pig)9823UniRef100_A0A480E4X2
UniRef90_F1RJ15
945
A5GFP4A5GFP4_PIGSynaptonemal complex protein 2 (Fragment)Sus scrofa (Pig)9823UniRef100_A0A480E4X2
UniRef90_F1RJ15
1,079
A0A287DAS2A0A287DAS2_ICTTRSYCP2_ARLD domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_A0A287DAS2
UniRef90_A0A287DAS2
200
G3T6D5G3T6D5_LOXAFSynaptonemal complex protein 2Loxodonta africana (African elephant)9785UniRef100_G3T6D5
UniRef90_G3T6D5
1,516
G3UJ85G3UJ85_LOXAFSynaptonemal complex protein 2Loxodonta africana (African elephant)9785UniRef100_G3UJ85
UniRef90_G3T6D5
1,515
M3W3I6M3W3I6_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3W3I6
UniRef90_M3W3I6
1,366
G1SKY5G1SKY5_RABITUncharacterized proteinOryctolagus cuniculus (Rabbit)9986UniRef100_G1SKY5
UniRef90_G1SKY5
1,441
A0A3Q2HTW6A0A3Q2HTW6_HORSESynaptonemal complex protein 2Equus caballus (Horse)9796UniRef100_A0A3Q2HTW6
UniRef90_A0A3Q2HTW6
1,402
F6W907F6W907_HORSESynaptonemal complex protein 2Equus caballus (Horse)9796UniRef100_F6W907
UniRef90_F6W907
1,459
A0A2Y9DAA5A0A2Y9DAA5_TRIMAsynaptonemal complex protein 2 isoform X3Trichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DAA5
UniRef90_A0A2Y9DAA5
1,570
A0A3L7HGR6A0A3L7HGR6_CRIGRSYCP2 (Fragment)Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A3L7HGR6
UniRef90_A0A3L7HGR6
1,479
A0A1S3A4P6A0A1S3A4P6_ERIEUsynaptonemal complex protein 2Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S3A4P6
UniRef90_A0A1S3A4P6
1,443

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9CUU3

Checksumi: 3706CF5214C51829

FASTA1,500172,122
        10         20         30         40         50
MPVRPDLQQL EKCIDDALRK NDFKPLLALL QIDICEDVKI KCSKQFLRKL
60 70 80 90 100
DDLICRELNK KDIQTVSSIL ISIGRCSKNI FILGQAGLQT MIKQGLVQKM
110 120 130 140 150
VSWFENSKEI ILNQQQSKDE AVMNMIEDLF DLLMVIYDIS DEGKNQVLES
160 170 180 190 200
FIPQICALVI DSRVNFCIQQ EALKKMNLML DRIPQDANKI LSNQEMLTLM
210 220 230 240 250
SNMGERILDV GDYELQVGIV EALCRMTTEK RRQELAYEWF SMDFIANAFK
260 270 280 290 300
EIKDCEFETD CRIFLNLVNG ILGDKRRVYT FPCLSAFLGK YELQIPSDEK
310 320 330 340 350
LEEFWIDFNL GSHTLSFYIA GDEEDHQWEA VTVPEEKVQM YNIEVRESKK
360 370 380 390 400
LLTLTLKNIV KISKKEGKEL LFYFDESLEI TNVTKKVFGG NKYKEFTRKQ
410 420 430 440 450
GISVAKTSIH VLFDASGSQI LVPESQPSPV KENLIHLKEK SDIQKKLVNP
460 470 480 490 500
LELGNSSSQD EITTPSRKKM SEASMIVPDT DRYTVRSPIL LINTSTPRRS
510 520 530 540 550
REPLQAINSV EKAVSKTSES GMDYAASPKS RQSDGRKRWN NRANHNKTTA
560 570 580 590 600
VIQNKQYEDN ESPDQNFNEI EDTLSNVSSA VGKVDKPVLP GVLDISKNTT
610 620 630 640 650
HSRWACWTPV TTIKLCNNQR SRALPGDTCT QDTGVNKKCT KQKSVSDDDS
660 670 680 690 700
EETQKGKYSK DVIKCNKSDE AEFCERNIQE QNHPKYSQKK NTANAKKSDW
710 720 730 740 750
HIESETTYKS VLLNKTTEES LIYKKTCVLS KDVNTTICDK SPSRKSKRNH
760 770 780 790 800
TKSRKELMSE LTSCELEEIP VRENSKGKRF TGASESLINQ ISRRYNPSDS
810 820 830 840 850
MMSTRKLKEP QDGSGFSKKP DLQFNKVQRK SYRKLKATVV NVTSECPLDD
860 870 880 890 900
VYNFSLNGAD EPVIKLGIQE FQATTREASM DNSLKLVKNH DEHDPFLKTK
910 920 930 940 950
DKRMLSYEKK TLLSDTETEC GCDDSKTDIS WLKEPKTKRL MDYSRNKNTT
960 970 980 990 1000
KYKSRKSRSS MEKGQPRPTM VLNKNSMKND YEVVVDGRTR LPRRATKTKK
1010 1020 1030 1040 1050
NYKDLSTSES ESESEKECSY LFKDKLPTKE ETIHSRAQTK KLPEKQQKVF
1060 1070 1080 1090 1100
NSEALKGQPS EEQKNSSRLR EGREDSLCLS SASVSRSSSS VEVMRCTEKI
1110 1120 1130 1140 1150
TERDFTQDYD YITKSLSPYP KAPSPEFLNG NNSVVGRGQS PRISETSAMC
1160 1170 1180 1190 1200
VRKSYSPASG PPFSPRHTPT KNNSVVNMKK ANSVINNQRT QHCNSYSDVS
1210 1220 1230 1240 1250
SNSSEKLYME PESPESCDNH MQNKREGNHA ASPLSLSSEK IEKMWFDMPS
1260 1270 1280 1290 1300
ENTHVSGPSQ RGSKRRMYLE DDELSNSNEA EVEEAEEREH LLSKKRCQWE
1310 1320 1330 1340 1350
NSDQHTFKTS LSTPDFSVPK DWQQELQGAG MFYDNISSDY KRKTDSQHKI
1360 1370 1380 1390 1400
MDDFTTKTLK LTQQHLMAMT SQAQGRRDEN VEKFQVTLLD ELEKVEKDSQ
1410 1420 1430 1440 1450
TLRDLEKELV DIEEKLVQKM RAYHRCERER FRVLKTSLDK SFLVYNSVYE
1460 1470 1480 1490 1500
ESVFTSEMCL MKANMKMLQD KLLKEMHEEE VLNIRRGLQS LFKAHEGNDA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again