Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9FAB5 Coagulase (Fragment) n=13 Tax=Staphylococcus aureus TaxID=1280 RepID=Q9FAB5_STAAU ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQK KPSKTNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHANGQVSYGARPTYKKPSETN AYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK

Members

List component clusters with 100% or 90% identity.
1 to 13 of 13  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9FAB5Q9FAB5_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9FAB5
UniRef90_Q9FAB5
167Representative & Seed
Q9KW71Q9KW71_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9KW71
UniRef90_Q9FAB5
167
Q9KW81Q9KW81_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9KW81
UniRef90_Q9FAB5
167
Q9FAB4Q9FAB4_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9FAB4
UniRef90_Q9FAB5
167
Q9KW80Q9KW80_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9KW80
UniRef90_Q9FAB5
167
Q9KW82Q9KW82_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9KW82
UniRef90_Q9FAB5
167
A0A1P8NTM6A0A1P8NTM6_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_A0A1P8NTM6
UniRef90_Q9FAB5
143
A0A1B1HVB3A0A1B1HVB3_STAAUStaphylocoagulase (Fragment)Staphylococcus aureus1280UniRef100_A0A1B1HVB3
UniRef90_A0A1B1HVB3
162
A0A1B1HVB5A0A1B1HVB5_STAAUStaphylocoagulase (Fragment)Staphylococcus aureus1280UniRef100_A0A1B1HVB5
UniRef90_A0A1B1HVB5
159
B2CGY0B2CGY0_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_B2CGY0
UniRef90_B2CGY0
152
A0A068FIU9A0A068FIU9_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_A0A068FIU9
UniRef90_E5LFX1
115
E5LFX1E5LFX1_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_E5LFX1
UniRef90_E5LFX1
115
UPI0004BC8456hypothetical proteinStaphylococcus aureus1280UniRef100_UPI0004BC8456
UniRef90_E5LFX1
134

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9FAB5

Checksumi: 4049791CFF73A185

FASTA16718,061
        10         20         30         40         50
ARPRFNKPSE TNAYNVTTNQ DGTVSYGARP TQNKPSETNA YNVTTHANGQ
60 70 80 90 100
VSYGARPTQK KPSKTNAYNV TTHANGQVSY GARPTQKKPS ETNAYNVTTH
110 120 130 140 150
ANGQVSYGAR PTYKKPSETN AYNVTTHANG QVSYGARPTQ KKPSETNAYN
160
VTTHADGTAT YGPRVTK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again