Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9H6Q3-2 Isoform 2 of Src-like-adapter 2 n=12 Tax=Eutheria TaxID=9347 RepID=Isoform 2 of SLAP2_HUMAN MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLT IVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI RESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSEGW PAPWQGYTPTCDCAEDTTQLERAGQLPPVF

Members

List component clusters with 100% or 90% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9H6Q3-2Isoform 2 of SLAP2_HUMAN2, p23, SLAP-2-v, MARS-vHomo sapiens (Human)9606UniRef100_Q9H6Q3-2
UniRef90_Q9H6Q3-2
210Representative
Q9H6Q3-4Isoform 4 of SLAP2_HUMAN4, p20Homo sapiens (Human)9606UniRef100_Q9H6Q3-2
UniRef90_Q9H6Q3-2
183
A0A2J8ML06A0A2J8ML06_PANTRSLA2 isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8ML06
UniRef90_Q9H6Q3-2
210
A0A2J8VJL7A0A2J8VJL7_PONABSLA2 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VJL7
UniRef90_Q9H6Q3-2
210Seed
F7GWU7F7GWU7_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7GWU7
UniRef90_Q9H6Q3-2
205
A0A481ABF0A0A481ABF0_PIGSrc-like-adapter 2 isoform X1Sus scrofa (Pig)9823UniRef100_A0A481ABF0
UniRef90_A0A480R9J9
148
A0A480R9J9A0A480R9J9_PIGSrc-like-adapter 2 isoform X1Sus scrofa (Pig)9823UniRef100_A0A480R9J9
UniRef90_A0A480R9J9
180
A0A481A4Q0A0A481A4Q0_PIGSrc-like-adapter 2 isoform X1Sus scrofa (Pig)9823UniRef100_A0A481A4Q0
UniRef90_A0A480R9J9
148
UPI00020A9E33src-like-adapter 2 isoform X2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00020A9E33
UniRef90_Q9H6Q3-2
210
UPI00029DA77Dsrc-like-adapter 2 isoform X3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI00029DA77D
UniRef90_Q9H6Q3-2
210
UPI000333A1CBsrc-like-adapter 2Echinops telfairi (Lesser hedgehog tenrec)9371UniRef100_UPI000333A1CB
UniRef90_UPI000333A1CB
209
UPI0003C0DD83Src-like-adapter 2Homo sapiens (Human)9606UniRef100_UPI0003C0DD83
UniRef90_UPI0003C0DD83
170

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9H6Q3-2

Checksumi: BED62208E53A472E

FASTA21023,103
        10         20         30         40         50
MGSLPSRRKS LPSPSLSSSV QGQGPVTMEA ERSKATAVAL GSFPAGGPAE
60 70 80 90 100
LSLRLGEPLT IVSEDGDWWT VLSEVSGREY NIPSVHVAKV SHGWLYEGLS
110 120 130 140 150
REKAEELLLL PGNPGGAFLI RESQTRRGSY SLSVRLSRPA SWDRIRHYRI
160 170 180 190 200
HCLDNGWLYI SPRLTFPSLQ ALVDHYSEGW PAPWQGYTPT CDCAEDTTQL
210
ERAGQLPPVF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again