Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9HEY7 Superoxide dismutase [Cu-Zn] n=110 Tax=Eukaryota TaxID=2759 RepID=SODC_EMENI MVKAVAVLRGDSKVSGTVTFEQADENSNTTVSWNITGNDPNAERGFHIHQFGDNTNGCTS AGPHFNPFGKTHGAPEDEVRHVGDLGNFKTDAEGNSKGSKTDKLIKLIGAESVLGRTLVV HAGTDDLGRGDSEESKKTGNAGARPACGVIGIAA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 110  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9HEY7SODC_EMENISuperoxide dismutase [Cu-Zn]Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)227321UniRef100_Q9HEY7
UniRef90_Q9HEY7
154Representative
P24706SODC_ONCVOSuperoxide dismutase [Cu-Zn]Onchocerca volvulus6282UniRef100_P24706
UniRef90_P24706
158
A0A3D8RA66A0A3D8RA66_9EUROSuperoxide dismutase [Cu-Zn]Aspergillus mulundensis1810919UniRef100_A0A3D8RA66
UniRef90_Q9HEY7
154
A0A2U3E6J5A0A2U3E6J5_PURLISuperoxide dismutase [Cu-Zn]Purpureocillium lilacinum (Paecilomyces lilacinus)33203UniRef100_A0A2U3E6J5
UniRef90_A0A2U3E6J5
195
A0A0D1ZFZ6A0A0D1ZFZ6_9EUROSuperoxide dismutase [Cu-Zn]Cladophialophora immunda569365UniRef100_A0A0D1ZFZ6
UniRef90_A0A0D2G5K7
154
A0A0D2HYG7A0A0D2HYG7_XYLBASuperoxide dismutase [Cu-Zn]Cladophialophora bantiana CBS 173.521442370UniRef100_A0A0D2HYG7
UniRef90_A0A0D2G5K7
182
A0A0D2FT61A0A0D2FT61_9EUROSuperoxide dismutase [Cu-Zn]Phialophora americana5601UniRef100_A0A0D2FT61
UniRef90_A0A0D2G5K7
154
A0A0D2IAP3A0A0D2IAP3_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea multimorphosa CBS 1022261442371UniRef100_A0A0D2IAP3
UniRef90_A0A0D2G5K7
154
A0A178BQH5A0A178BQH5_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea multimorphosa979981UniRef100_A0A0D2IAP3
UniRef90_A0A0D2G5K7
154
W9XF74W9XF74_9EUROSuperoxide dismutase [Cu-Zn]Cladophialophora psammophila CBS 1105531182543UniRef100_W9XF74
UniRef90_A0A0D2G5K7
154
A0A177FGI6A0A177FGI6_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea monophora254056UniRef100_A0A177FGI6
UniRef90_A0A0D2G5K7
154
A0A0D2DCV8A0A0D2DCV8_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea pedrosoi CBS 271.371442368UniRef100_A0A177FGI6
UniRef90_A0A0D2G5K7
154
A0A178CXL8A0A178CXL8_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea nubica856822UniRef100_A0A178CXL8
UniRef90_A0A0D2G5K7
154
A0A0D2G5K7A0A0D2G5K7_9EUROSuperoxide dismutase [Cu-Zn]Rhinocladiella mackenziei CBS 650.931442369UniRef100_A0A0D2G5K7
UniRef90_A0A0D2G5K7
154
A0A178ZA96A0A178ZA96_9EUROSuperoxide dismutase [Cu-Zn]Fonsecaea erecta1367422UniRef100_A0A178ZA96
UniRef90_A0A0D2G5K7
154
A0A167VAR7A0A167VAR7_9PEZISuperoxide dismutase [Cu-Zn]Sporothrix insectorum RCEF 2641081102UniRef100_A0A167VAR7
UniRef90_A0A167VAR7
173
A0A0J0AQ97A0A0J0AQ97_GIBFUSuperoxide dismutase [Cu-Zn]Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi)5127UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
A0A365ND57A0A365ND57_GIBINSuperoxide dismutase [Cu-Zn]Gibberella intermedia (Bulb rot disease fungus) (Fusarium proliferatum)948311UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
A0A1L7T699A0A1L7T699_FUSMASuperoxide dismutase [Cu-Zn]Fusarium mangiferae (Mango malformation disease fungus)192010UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
A0A366PRE7A0A366PRE7_GIBMOSuperoxide dismutase [Cu-Zn]Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides)117187UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
A0A1L7VPN0A0A1L7VPN0_FUSPRSuperoxide dismutase [Cu-Zn]Fusarium proliferatum (strain ET1) (Orchid endophyte fungus)1227346UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
S0EAI1S0EAI1_GIBF5Superoxide dismutase [Cu-Zn]Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi)1279085UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
W7LK20W7LK20_GIBM7Superoxide dismutase [Cu-Zn]Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides)334819UniRef100_A0A0J0AQ97
UniRef90_A0A0A1TD43
154
A0A2L2SW94A0A2L2SW94_9HYPOSuperoxide dismutase [Cu-Zn]Fusarium venenatum56646UniRef100_A0A2L2SW94
UniRef90_A0A0A1TD43
191
C7YME4C7YME4_NECH7Superoxide dismutase [Cu-Zn]Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)660122UniRef100_C7YME4
UniRef90_A0A0A1TD43
154

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9HEY7

Checksumi: 88D5F231F6F5F5E1

FASTA15415,988
        10         20         30         40         50
MVKAVAVLRG DSKVSGTVTF EQADENSNTT VSWNITGNDP NAERGFHIHQ
60 70 80 90 100
FGDNTNGCTS AGPHFNPFGK THGAPEDEVR HVGDLGNFKT DAEGNSKGSK
110 120 130 140 150
TDKLIKLIGA ESVLGRTLVV HAGTDDLGRG DSEESKKTGN AGARPACGVI

GIAA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again