Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9QYR7 Acyl-coenzyme A thioesterase 3 n=207 Tax=Euteleostomi TaxID=117571 RepID=ACOT3_MOUSE MHAFTTQNPNRMAPTVILEPAGGCLCDQPVHIAVRGLAPEQPVTLRSVLRDEKGALFRAH ARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQTPFVVELEVL DGHEPDGGQRLARAVHERHFMAPGVRRVPVREGRVRATLFLPPGTGPFPGIIDLFGIGSG LLEYRASLLAGKGFAVMALAYNNYEDLPKDMDIIHLEYFEEAVTYLLSHPQVTGSGVGVL GISKGGELGFAMASFLKNITAAVIINGSISNIGGNLQYKDETVPSVGINTKRVKRTKDGL KDIVDLLNNPLEGPDQKSLIPVERSDTAFLFLVGQDDHNWKSEFYAREASKRLQAHGKEK PQIICYPETGHHIEPPYFPLCKASLNSLVGGPVIWGGEPRAHAMAQVDAWQQLQTFFHNH LDGKKKTIPAKL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 207  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9QYR7ACOT3_MOUSEAcyl-coenzyme A thioesterase 3Mus musculus (Mouse)10090UniRef100_Q9QYR7
UniRef90_Q9QYR7
432Representative
O55171ACOT2_RATAcyl-coenzyme A thioesterase 2, mitochondrialRattus norvegicus (Rat)10116UniRef100_O55171
UniRef90_O55171
453
Q9QYR9ACOT2_MOUSEAcyl-coenzyme A thioesterase 2, mitochondrialMus musculus (Mouse)10090UniRef100_Q9QYR9
UniRef90_O55171
453
O88267ACOT1_RATAcyl-coenzyme A thioesterase 1Rattus norvegicus (Rat)10116UniRef100_O88267
UniRef90_O55171
419
Q6Q2Z6ACOT5_MOUSEAcyl-coenzyme A thioesterase 5Mus musculus (Mouse)10090UniRef100_Q6Q2Z6
UniRef90_Q6Q2Z6
421
Q8N9L9ACOT4_HUMANPeroxisomal succinyl-coenzyme A thioesteraseHomo sapiens (Human)9606UniRef100_Q8N9L9
UniRef90_Q8N9L9
421
Q32Q92ACOT6_MOUSEAcyl-coenzyme A thioesterase 6Mus musculus (Mouse)10090UniRef100_Q32Q92
UniRef90_Q32Q92
419
Q8BWN8ACOT4_MOUSEPeroxisomal succinyl-coenzyme A thioesteraseMus musculus (Mouse)10090UniRef100_Q8BWN8
UniRef90_Q8BWN8
421
Q53YL1Q53YL1_MOUSEAcyl-CoA thioesterase 3Mus musculus (Mouse)10090UniRef100_Q9QYR7
UniRef90_Q9QYR7
432
Q9QYR7-2Isoform 2 of ACOT3_MOUSE2, PTE-Ia 5':2Mus musculus (Mouse)10090UniRef100_Q9QYR7
UniRef90_Q9QYR7
421
A0A1L8EZW0A0A1L8EZW0_XENLAUncharacterized proteinXenopus laevis (African clawed frog)8355UniRef100_A0A1L8EZW0
UniRef90_Q6NTQ4
436
Q6NTQ4Q6NTQ4_XENLAMGC83099 proteinXenopus laevis (African clawed frog)8355UniRef100_Q6NTQ4
UniRef90_Q6NTQ4
428
A0A2K6GPL1A0A2K6GPL1_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6GPL1
UniRef90_H0Y1M2
421
H0Y1M2H0Y1M2_OTOGAUncharacterized proteinOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_H0Y1M2
UniRef90_H0Y1M2
363
A0A4W2GZQ2A0A4W2GZQ2_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2GZQ2
UniRef90_A0A3S5ZPS3
416
A0A4W2GZQ8A0A4W2GZQ8_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2GZQ8
UniRef90_A0A3S5ZPS3
424
A0A3S5ZPS3A0A3S5ZPS3_BOVINUncharacterized proteinBos taurus (Bovine)9913UniRef100_A0A3S5ZPS3
UniRef90_A0A3S5ZPS3
424
A5PJL7A5PJL7_BOVINMGC160092 proteinBos taurus (Bovine)9913UniRef100_A0A3S5ZPS3
UniRef90_A0A3S5ZPS3
416
A0A1U7QUR1A0A1U7QUR1_MESAUacyl-coenzyme A thioesterase 5-like isoform X2Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QUR1
UniRef90_A0A1U7QUR1
421
A0A480S6E5A0A480S6E5_PIGAcyl-coenzyme A thioesterase 4Sus scrofa (Pig)9823UniRef100_A0A480S6E5
UniRef90_A0A480S6E5
459
A0A4U5T572A0A4U5T572_CAMDRUncharacterized proteinCamelus dromedarius (Dromedary) (Arabian camel)9838UniRef100_A0A4U5T572
UniRef90_A0A4U5T572
448
G3HNG2G3HNG2_CRIGRAcyl-coenzyme A thioesterase 2, mitochondrialCricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_G3HNG2
UniRef90_G3HNG2
455
A0A3L7HJ01A0A3L7HJ01_CRIGRACOT2Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A3L7HJ01
UniRef90_G3HNG2
501Seed
A0A1L8FAK3A0A1L8FAK3_XENLAUncharacterized proteinXenopus laevis (African clawed frog)8355UniRef100_A0A1L8FAK3
UniRef90_A0A1L8FAK3
439
H0V390H0V390_CAVPOUncharacterized proteinCavia porcellus (Guinea pig)10141UniRef100_H0V390
UniRef90_H0V390
418

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9QYR7

Checksumi: BF5888C59C015359

FASTA43247,489
        10         20         30         40         50
MHAFTTQNPN RMAPTVILEP AGGCLCDQPV HIAVRGLAPE QPVTLRSVLR
60 70 80 90 100
DEKGALFRAH ARYRADSHGE LDLARTPALG GSFSGLEPMG LLWAMEPDRP
110 120 130 140 150
FWRLIKRDVQ TPFVVELEVL DGHEPDGGQR LARAVHERHF MAPGVRRVPV
160 170 180 190 200
REGRVRATLF LPPGTGPFPG IIDLFGIGSG LLEYRASLLA GKGFAVMALA
210 220 230 240 250
YNNYEDLPKD MDIIHLEYFE EAVTYLLSHP QVTGSGVGVL GISKGGELGF
260 270 280 290 300
AMASFLKNIT AAVIINGSIS NIGGNLQYKD ETVPSVGINT KRVKRTKDGL
310 320 330 340 350
KDIVDLLNNP LEGPDQKSLI PVERSDTAFL FLVGQDDHNW KSEFYAREAS
360 370 380 390 400
KRLQAHGKEK PQIICYPETG HHIEPPYFPL CKASLNSLVG GPVIWGGEPR
410 420 430
AHAMAQVDAW QQLQTFFHNH LDGKKKTIPA KL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again