Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9QZS3-2 Isoform 2 of Protein numb homolog n=726 Tax=Vertebrata TaxID=7742 RepID=Isoform 2 of NUMB_MOUSE MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA TFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPS SPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE LPSTMQRKTDFPIKNTVPEVEGEAESISSLCSQITSAFSTPSEDPFSSAPMTKPVTLVAP QSPVLQGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQVSAAPLQPVL QPPPPAAIAPPAPPFQGHAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGMPYPASNVPVV GITPSQMVANVFGTAGHPQTTHPHQSPSLAKQQTFPQYETSSATTSPFFKPPAQHLNGSA AFNGVDNGGLASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF EIEL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 726  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9QZS3-2Isoform 2 of NUMB_MOUSE2, p66, 66 kDaMus musculus (Mouse)10090UniRef100_Q9QZS3-2
UniRef90_Q9QZS3-2
604Representative
Q2LC87Q2LC87_RATNumb isoform i/oRattus norvegicus (Rat)10116UniRef100_Q2LC87
UniRef90_Q9QZS3-2
603
Q9QZS3-4Isoform 4 of NUMB_MOUSE4, p65, 65 kDaMus musculus (Mouse)10090UniRef100_Q9QZS3-4
UniRef90_Q9QZS3-2
593
Q2LC86Q2LC86_RATNumb isoform o/oRattus norvegicus (Rat)10116UniRef100_Q2LC86
UniRef90_Q9QZS3-2
592
Q3MUI1Q3MUI1_RATNumbRattus norvegicus (Rat)10116UniRef100_Q3MUI1
UniRef90_Q9QZS3-2
592
Q1XD15Q1XD15_DANRENumbDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q1XD15
UniRef90_F1QPD8
680
B3DG87B3DG87_DANRENumb homolog (Drosophila)Danio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_B3DG87
UniRef90_F1QPD8
680
F1QPD8F1QPD8_DANRENUMB endocytic adaptor proteinDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_F1QPD8
UniRef90_F1QPD8
680
F1RDZ7F1RDZ7_DANRENUMB endocytic adaptor proteinDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_F1RDZ7
UniRef90_F1QPD8
669
Q1XD14Q1XD14_DANRENumbDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q1XD14
UniRef90_F1QPD8
669
X1WE89X1WE89_DANRENUMB endocytic adaptor protein (Fragment)Danio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_X1WE89
UniRef90_F1QPD8
208
A0A3B4ZNB8A0A3B4ZNB8_9TELEPID domain-containing proteinStegastes partitus (bicolor damselfish)144197UniRef100_A0A3B4ZNB8
UniRef90_A0A3B4ZNB8
672
A0A4U5VJ70A0A4U5VJ70_COLLUProtein numb-like proteinCollichthys lucidus (Big head croaker) (Sciaena lucida)240159UniRef100_A0A4U5VJ70
UniRef90_A0A3B4ZNB8
662
A0A3B4Z378A0A3B4Z378_9TELEPID domain-containing proteinStegastes partitus (bicolor damselfish)144197UniRef100_A0A3B4Z378
UniRef90_A0A3B4ZNB8
661
A0A4W6D8Q7A0A4W6D8Q7_LATCAPID domain-containing proteinLates calcarifer (Barramundi) (Holocentrus calcarifer)8187UniRef100_A0A4W6D8Q7
UniRef90_A0A3B4ZNB8
659
A0A4W6D9B9A0A4W6D9B9_LATCAPID domain-containing proteinLates calcarifer (Barramundi) (Holocentrus calcarifer)8187UniRef100_A0A4W6D9B9
UniRef90_A0A3B4ZNB8
648
A0A4U5VGH7A0A4U5VGH7_COLLUProtein numb-like proteinCollichthys lucidus (Big head croaker) (Sciaena lucida)240159UniRef100_A0A4U5VGH7
UniRef90_A0A3B4ZNB8
641
A0A3Q3GBD8A0A3Q3GBD8_9LABRPID domain-containing proteinLabrus bergylta (ballan wrasse)56723UniRef100_A0A3Q3GBD8
UniRef90_A0A3B4ZNB8
617
A0A4W6D924A0A4W6D924_LATCAPID domain-containing proteinLates calcarifer (Barramundi) (Holocentrus calcarifer)8187UniRef100_A0A4W6D924
UniRef90_A0A3B4ZNB8
615
A0A3B4X994A0A3B4X994_SERLLPID domain-containing proteinSeriola lalandi dorsalis1841481UniRef100_A0A3B4X994
UniRef90_A0A3B4ZNB8
574
U3DG75U3DG75_CALJAProtein numb homolog isoform 3Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3DG75
UniRef90_A0A2K5R4U1
641
U3B7N7U3B7N7_CALJAProtein numb homolog isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3B7N7
UniRef90_A0A2K5R4U1
652
A0A2K5R4U1A0A2K5R4U1_CEBCAPID domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5R4U1
UniRef90_A0A2K5R4U1
621
A0A2K5R532A0A2K5R532_CEBCANumbF domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5R4U1
UniRef90_A0A2K5R4U1
502
A0A3P9GYD7A0A3P9GYD7_ORYLAPID domain-containing proteinOryzias latipes (Japanese rice fish) (Japanese killifish)8090UniRef100_A0A3P9GYD7
UniRef90_A0A3P9GYD7
564

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9QZS3-2

Checksumi: 709C36BE4DEF6AE0

FASTA60465,766
        10         20         30         40         50
MNKLRQSFRR KKDVYVPEAS RPHQWQTDEE GVRTGKCSFP VKYLGHVEVD
60 70 80 90 100
ESRGMHICED AVKRLKAERK FFKGFFGKTG KKAVKAVLWV SADGLRVVDE
110 120 130 140 150
KTKDLIVDQT IEKVSFCAPD RNFDRAFSYI CRDGTTRRWI CHCFMAVKDT
160 170 180 190 200
GERLSHAVGC AFAACLERKQ KREKECGVTA TFDASRTTFT REGSFRVTTA
210 220 230 240 250
TEQAEREEIM KQLQDAKKAE TDKTVVGPSV APGNTAPSPS SPTSPTPDGT
260 270 280 290 300
ASSEMNNPHA IPRRHAPIEQ LARQGSFRGF PALSQKMSPF KRQLSLRINE
310 320 330 340 350
LPSTMQRKTD FPIKNTVPEV EGEAESISSL CSQITSAFST PSEDPFSSAP
360 370 380 390 400
MTKPVTLVAP QSPVLQGTEW GQSSGAASPG LFQAGHRRTP SEADRWLEEV
410 420 430 440 450
SKSVRAQQPQ VSAAPLQPVL QPPPPAAIAP PAPPFQGHAF LTSQPVPVGV
460 470 480 490 500
VPPLQPAFVP TQSYPVANGM PYPASNVPVV GITPSQMVAN VFGTAGHPQT
510 520 530 540 550
THPHQSPSLA KQQTFPQYET SSATTSPFFK PPAQHLNGSA AFNGVDNGGL
560 570 580 590 600
ASGNRHAEVP PGTCPVDPFE AQWAALESKS KQRTNPSPTN PFSSDLQKTF

EIEL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again