Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9UKG1 DCC-interacting protein 13-alpha n=338 Tax=Euteleostomi TaxID=117571 RepID=DP13A_HUMAN MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTN PFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRM TESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLS SVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIE KDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 338  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9UKG1DP13A_HUMANDCC-interacting protein 13-alphaHomo sapiens (Human)9606UniRef100_Q9UKG1
UniRef90_Q9UKG1
709Representative
H2QMU0H2QMU0_PANTRAPPL1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_Q9UKG1
UniRef90_Q9UKG1
709
A0A2R9BK75A0A2R9BK75_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BK75
UniRef90_Q9UKG1
709
A0A2J8T167A0A2J8T167_PONABAPPL1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8T167
UniRef90_Q9UKG1
709
A0A1D5RFG9A0A1D5RFG9_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RFG9
UniRef90_Q9UKG1
709
H9EQ29H9EQ29_MACMUDCC-interacting protein 13-alphaMacaca mulatta (Rhesus macaque)9544UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A2K5MZU1A0A2K5MZU1_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A096MVI7A0A096MVI7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A0D9RK09A0A0D9RK09_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A2K5UAG7A0A2K5UAG7_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A2K6C620A0A2K6C620_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_H9EQ29
UniRef90_Q9UKG1
709
A0A2K5XM13A0A2K5XM13_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_H9EQ29
UniRef90_Q9UKG1
691
A0A2K6MPW1A0A2K6MPW1_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6MPW1
UniRef90_Q9UKG1
707
A0A2K5XM16A0A2K5XM16_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XM16
UniRef90_Q9UKG1
694
A0A2K6PRG8A0A2K6PRG8_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PRG8
UniRef90_Q9UKG1
693
G7NZD1G7NZD1_MACFAUncharacterized protein (Fragment)Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7NZD1
UniRef90_Q9UKG1
692
A0A1D5QC91A0A1D5QC91_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QC91
UniRef90_Q9UKG1
671
A0A2K5JN11A0A2K5JN11_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5JN11
UniRef90_Q9UKG1
658
A0A2I3TCM3A0A2I3TCM3_PANTRAdaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TCM3
UniRef90_Q9UKG1
648
A0A2R9BJH1A0A2R9BJH1_PANPAPID domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BJH1
UniRef90_Q9UKG1
648
G3S7H0G3S7H0_GORGOAdaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S7H0
UniRef90_Q9UKG1
646
A0A2K5XM26A0A2K5XM26_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XM26
UniRef90_Q9UKG1
640
G7ML09G7ML09_MACMUPID domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7ML09
UniRef90_Q9UKG1
633
B4DQX8B4DQX8_HUMANcDNA FLJ51723, highly similar to DCC-interacting protein 13 alpha (Fragment)Homo sapiens (Human)9606UniRef100_B4DQX8
UniRef90_Q9UKG1
633
C9JAB0C9JAB0_HUMANDCC-interacting protein 13-alpha (Fragment)Homo sapiens (Human)9606UniRef100_B4DQX8
UniRef90_Q9UKG1
133

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9UKG1

Checksumi: 4CABECFCF4BB110D

FASTA70979,663
        10         20         30         40         50
MPGIDKLPIE ETLEDSPQTR SLLGVFEEDA TAISNYMNQL YQAMHRIYDA
60 70 80 90 100
QNELSAATHL TSKLLKEYEK QRFPLGGDDE VMSSTLQQFS KVIDELSSCH
110 120 130 140 150
AVLSTQLADA MMFPITQFKE RDLKEILTLK EVFQIASNDH DAAINRYSRL
160 170 180 190 200
SKKRENDKVK YEVTEDVYTS RKKQHQTMMH YFCALNTLQY KKKIALLEPL
210 220 230 240 250
LGYMQAQISF FKMGSENLNE QLEEFLANIG TSVQNVRREM DSDIETMQQT
260 270 280 290 300
IEDLEVASDP LYVPDPDPTK FPVNRNLTRK AGYLNARNKT GLVSSTWDRQ
310 320 330 340 350
FYFTQGGNLM SQARGDVAGG LAMDIDNCSV MAVDCEDRRY CFQITSFDGK
360 370 380 390 400
KSSILQAESK KDHEEWICTI NNISKQIYLS ENPEETAARV NQSALEAVTP
410 420 430 440 450
SPSFQQRHES LRPAAGQSRP PTARTSSSGS LGSESTNLAA LSLDSLVAPD
460 470 480 490 500
TPIQFDIISP VCEDQPGQAK AFGQGGRRTN PFGESGGSTK SETEDSILHQ
510 520 530 540 550
LFIVRFLGSM EVKSDDHPDV VYETMRQILA ARAIHNIFRM TESHLLVTCD
560 570 580 590 600
CLKLIDPQTQ VTRLTFPLPC VVLYATHQEN KRLFGFVLRT SSGRSESNLS
610 620 630 640 650
SVCYIFESNN EGEKICDSVG LAKQIALHAE LDRRASEKQK EIERVKEKQQ
660 670 680 690 700
KELNKQKQIE KDLEEQSRLI AASSRPNQAS SEGQFVVLSS SQSEESDLGE

GGKKRESEA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again