Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9Y3A2-2 Isoform 2 of Probable U3 small nucleolar RNA-associated protein 11 n=3 Tax=Boreoeutheria TaxID=1437010 RepID=Isoform 2 of UTP11_HUMAN MAAAFRKAAKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALE KNPDEFYYKMTRVKLQDGVHIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLK SELHLLDFQGKQQNKHVFFFDTKKEANS

Members

List component clusters with 100% or 90% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y3A2-2Isoform 2 of UTP11_HUMAN2Homo sapiens (Human)9606UniRef100_Q9Y3A2-2
UniRef90_Q9Y3A2-2
148Representative
A0A480RZR0A0A480RZR0_PIGPutative U3 small nucleolar RNA-associated protein 11Sus scrofa (Pig)9823UniRef100_A0A480RZR0
UniRef90_Q9Y3A2-2
157Seed
A0A480W9G8A0A480W9G8_PIGPutative U3 small nucleolar RNA-associated protein 11Sus scrofa (Pig)9823UniRef100_A0A480W9G8
UniRef90_Q9Y3A2-2
156

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y3A2-2

Checksumi: CCC12EAD8FF3A044

FASTA14817,869
        10         20         30         40         50
MAAAFRKAAK SRQREHRERS QPGFRKHLGL LEKKKDYKLR ADDYRKKQEY
60 70 80 90 100
LKALRKKALE KNPDEFYYKM TRVKLQDGVH IIKETKEEVT PEQLKLMRTQ
110 120 130 140
DVKYIEMKRV AEAKKIERLK SELHLLDFQG KQQNKHVFFF DTKKEANS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again