Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9Y5U2 Protein TSSC4 n=131 Tax=Eutheria TaxID=9347 RepID=TSSC4_HUMAN MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDS GPDEPPSPPSGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNG GFKRPLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQA TALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGR GGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE TVGFHGSRKRSRDHFRNKSSSPEDPGAEV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 131  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y5U2TSSC4_HUMANProtein TSSC4Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
329Representative
Q1LZD3TSSC4_BOVINProtein TSSC4Bos taurus (Bovine)9913UniRef100_Q1LZD3
UniRef90_Q1LZD3
325
E9PL88E9PL88_HUMANProtein TSSC4 (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
110
C9JDU0C9JDU0_HUMANProtein TSSC4 (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
112
E9PME3E9PME3_HUMANProtein TSSC4 (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
191
C9JHT9C9JHT9_HUMANProtein TSSC4 (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
203
A0A024RCB9A0A024RCB9_HUMANTumor suppressing subtransferable candidate 4, isoform CRA_aHomo sapiens (Human)9606UniRef100_A0A024RCB9
UniRef90_Q9Y5U2
329
F6Q7U7F6Q7U7_MACMUProtein TSSC4Macaca mulatta (Rhesus macaque)9544UniRef100_F6Q7U7
UniRef90_Q9Y5U2
329
G7PNX1G7PNX1_MACFATumor-suppressing subchromosomal transferable candidate gene 4 proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PNX1
UniRef90_Q9Y5U2
329
A0A0D9RBI1A0A0D9RBI1_CHLSBTumor suppressing subtransferable candidate 4Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RBI1
UniRef90_Q9Y5U2
329
K7BZ71K7BZ71_PANTRTSSC4 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_K7BZ71
UniRef90_Q9Y5U2
329
A0A2J8JV63A0A2J8JV63_PANTRTSSC4 isoform 9 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BZ71
UniRef90_Q9Y5U2
112
A0A2J8JV16A0A2J8JV16_PANTRTSSC4 isoform 10 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BZ71
UniRef90_Q9Y5U2
110
A0A2J8JV07A0A2J8JV07_PANTRTSSC4 isoform 7 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BZ71
UniRef90_Q9Y5U2
203
A0A2J8JV14A0A2J8JV14_PANTRTSSC4 isoform 8 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BZ71
UniRef90_Q9Y5U2
191
K6ZJP3K6ZJP3_PANTRTumor suppressing subtransferable candidate 4Pan troglodytes (Chimpanzee)9598UniRef100_K6ZJP3
UniRef90_Q9Y5U2
329
A0A2J8S6L8A0A2J8S6L8_PONABTSSC4 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S6L8
UniRef90_Q9Y5U2
329
A0A2J8S6I3A0A2J8S6I3_PONABTSSC4 isoform 8 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S6L8
UniRef90_Q9Y5U2
191
A0A2J8S6J0A0A2J8S6J0_PONABTSSC4 isoform 7 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S6L8
UniRef90_Q9Y5U2
203
A0A2J8S6J8A0A2J8S6J8_PONABTSSC4 isoform 10 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S6L8
UniRef90_Q9Y5U2
110
A0A2J8S6K5A0A2J8S6K5_PONABTSSC4 isoform 9 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S6L8
UniRef90_Q9Y5U2
112
H9FNE0H9FNE0_MACMUProtein TSSC4Macaca mulatta (Rhesus macaque)9544UniRef100_H9FNE0
UniRef90_Q9Y5U2
329
A0A5E4D512A0A5E4D512_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4D512
UniRef90_A0A5E4D512
304
A0A212DGJ5A0A212DGJ5_CEREHTSSC4Cervus elaphus hippelaphus (European red deer)46360UniRef100_A0A212DGJ5
UniRef90_Q1LZD3
331
A0A452EA35A0A452EA35_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452EA35
UniRef90_Q1LZD3
325

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y5U2

Checksumi: AFC2D5CBD93844F0

FASTA32934,326
        10         20         30         40         50
MAEAGTGEPS PSVEGEHGTE YDTLPSDTVS LSDSDSDLSL PGGAEVEALS
60 70 80 90 100
PMGLPGEEDS GPDEPPSPPS GLLPATVQPF HLRGMSSTFS QRSRDIFDCL
110 120 130 140 150
EGAARRAPSS VAHTSMSDNG GFKRPLAPSG RSPVEGLGRA HRSPASPRVP
160 170 180 190 200
PVPDYVAHPE RWTKYSLEDV TEVSEQSNQA TALAFLGSQS LAAPTDCVSS
210 220 230 240 250
FNQDPSSCGE GRVIFTKPVR GVEARHERKR VLGKVGEPGR GGLGNPATDR
260 270 280 290 300
GEGPVELAHL AGPGSPEAEE WGSHHGGLQE VEALSGSVHS GSVPGLPPVE
310 320
TVGFHGSRKR SRDHFRNKSS SPEDPGAEV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again