Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9Y5U2 Protein TSSC4 n=131 Tax=Eutheria TaxID=9347 RepID=TSSC4_HUMAN MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDS GPDEPPSPPSGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNG GFKRPLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQA TALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGR GGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE TVGFHGSRKRSRDHFRNKSSSPEDPGAEV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 67  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
UPI00045DFADCprotein TSSC4 isoform X4Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045DFADC
UniRef90_Q9Y5U2
332Seed
UPI00045DAA9Eprotein TSSC4 isoform X3Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045DFADC
UniRef90_Q9Y5U2
278
UPI00083C2FD5protein TSSC4 isoform X1Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_UPI00083C2FD5
UniRef90_Q9Y5U2
329
UPI0001FA2902protein TSSC4 isoform X1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0001FA2902
UniRef90_Q9Y5U2
329
UPI0010A20FE4protein TSSC4 isoform X1Macaca mulatta (Rhesus macaque)9544UniRef100_UPI0010A20FE4
UniRef90_Q9Y5U2
329
UPI000DC1A1FEprotein TSSC4 isoform X1Theropithecus gelada (Gelada baboon)9565UniRef100_UPI000DC1A1FE
UniRef90_Q9Y5U2
329
UPI0005F45A8Bprotein TSSC4Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F45A8B
UniRef90_Q9Y5U2
329
UPI0005330307protein TSSC4Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_UPI0005330307
UniRef90_Q9Y5U2
329
UPI0003AB9B5Aprotein TSSC4 isoform X1Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI0003AB9B5A
UniRef90_Q9Y5U2
329
UPI00075FA524protein TSSC4 isoform X4Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI0003AB9B5A
UniRef90_Q9Y5U2
245
UPI000E6AFB03protein TSSC4 isoform X1Piliocolobus tephrosceles (Ugandan red Colobus)591936UniRef100_UPI000E6AFB03
UniRef90_Q9Y5U2
329
UPI0004F1EABAprotein TSSC4Papio anubis (Olive baboon)9555UniRef100_UPI0004F1EABA
UniRef90_Q9Y5U2
329
UPI0005F57FEEprotein TSSC4 isoform X1Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_UPI0005F57FEE
UniRef90_Q9Y5U2
329
UPI0005F4F7E6protein TSSC4 isoform X1Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_UPI0005F4F7E6
UniRef90_Q9Y5U2
329
UPI00045DEF9Bprotein TSSC4 isoform X1Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_UPI00045DEF9B
UniRef90_Q9Y5U2
329
UPI0002744A6Dprotein TSSC4 isoform X1Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI0002744A6D
UniRef90_Q9Y5U2
329
UPI00122D9E4Bprotein TSSC4Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00122D9E4B
UniRef90_Q9Y5U2
328
UPI0003ABCA03protein TSSC4 isoform X2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI0003ABCA03
UniRef90_Q9Y5U2
307
UPI000333F344protein TSSC4Echinops telfairi (Lesser hedgehog tenrec)9371UniRef100_UPI000333F344
UniRef90_UPI000333F344
300
UPI0003333D93protein TSSC4Jaculus jaculus (Lesser Egyptian jerboa)51337UniRef100_UPI0003333D93
UniRef90_UPI0003333D93
320
UPI000737E240LOW QUALITY PROTEIN: protein TSSC4Vicugna pacos (Alpaca) (Lama pacos)30538UniRef100_UPI000737E240
UniRef90_UPI000737E240
268
UPI000298C68Eprotein TSSC4Felis catus (Cat) (Felis silvestris catus)9685UniRef100_UPI000298C68E
UniRef90_UPI000298C68E
320
UPI000F424A58protein TSSC4Acinonyx jubatus (Cheetah)32536UniRef100_UPI000F424A58
UniRef90_UPI000298C68E
322
UPI000905D49Bprotein TSSC4Panthera pardus (Leopard) (Felis pardus)9691UniRef100_UPI000905D49B
UniRef90_UPI000298C68E
318
UPI0003F07941protein TSSC4Elephantulus edwardii (Cape long-eared elephant shrew)28737UniRef100_UPI0003F07941
UniRef90_UPI0003F07941
295

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y5U2

Checksumi: AFC2D5CBD93844F0

FASTA32934,326
        10         20         30         40         50
MAEAGTGEPS PSVEGEHGTE YDTLPSDTVS LSDSDSDLSL PGGAEVEALS
60 70 80 90 100
PMGLPGEEDS GPDEPPSPPS GLLPATVQPF HLRGMSSTFS QRSRDIFDCL
110 120 130 140 150
EGAARRAPSS VAHTSMSDNG GFKRPLAPSG RSPVEGLGRA HRSPASPRVP
160 170 180 190 200
PVPDYVAHPE RWTKYSLEDV TEVSEQSNQA TALAFLGSQS LAAPTDCVSS
210 220 230 240 250
FNQDPSSCGE GRVIFTKPVR GVEARHERKR VLGKVGEPGR GGLGNPATDR
260 270 280 290 300
GEGPVELAHL AGPGSPEAEE WGSHHGGLQE VEALSGSVHS GSVPGLPPVE
310 320
TVGFHGSRKR SRDHFRNKSS SPEDPGAEV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again