Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9Y5U2 Protein TSSC4 n=131 Tax=Eutheria TaxID=9347 RepID=TSSC4_HUMAN MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDS GPDEPPSPPSGLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNG GFKRPLAPSGRSPVEGLGRAHRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQA TALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGR GGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSHHGGLQEVEALSGSVHSGSVPGLPPVE TVGFHGSRKRSRDHFRNKSSSPEDPGAEV

Members

List component clusters with 100% or 90% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y5U2TSSC4_HUMANProtein TSSC4Homo sapiens (Human)9606UniRef100_Q9Y5U2
UniRef90_Q9Y5U2
329Representative
Q1LZD3TSSC4_BOVINProtein TSSC4Bos taurus (Bovine)9913UniRef100_Q1LZD3
UniRef90_Q1LZD3
325

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y5U2

Checksumi: AFC2D5CBD93844F0

FASTA32934,326
        10         20         30         40         50
MAEAGTGEPS PSVEGEHGTE YDTLPSDTVS LSDSDSDLSL PGGAEVEALS
60 70 80 90 100
PMGLPGEEDS GPDEPPSPPS GLLPATVQPF HLRGMSSTFS QRSRDIFDCL
110 120 130 140 150
EGAARRAPSS VAHTSMSDNG GFKRPLAPSG RSPVEGLGRA HRSPASPRVP
160 170 180 190 200
PVPDYVAHPE RWTKYSLEDV TEVSEQSNQA TALAFLGSQS LAAPTDCVSS
210 220 230 240 250
FNQDPSSCGE GRVIFTKPVR GVEARHERKR VLGKVGEPGR GGLGNPATDR
260 270 280 290 300
GEGPVELAHL AGPGSPEAEE WGSHHGGLQE VEALSGSVHS GSVPGLPPVE
310 320
TVGFHGSRKR SRDHFRNKSS SPEDPGAEV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again