Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9Y5Y5 Peroxisomal membrane protein PEX16 n=194 Tax=cellular organisms TaxID=131567 RepID=PEX16_HUMAN MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAK AVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQ RSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARIL FLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

Members

List component clusters with 100% or 90% identity.
1 to 25 of 194  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9Y5Y5PEX16_HUMANPeroxisomal membrane protein PEX16Homo sapiens (Human)9606UniRef100_Q9Y5Y5
UniRef90_Q9Y5Y5
336Representative
Q91XC9PEX16_MOUSEPeroxisomal membrane protein PEX16Mus musculus (Mouse)10090UniRef100_Q91XC9
UniRef90_Q91XC9
336
Q2KII7PEX16_BOVINPeroxisomal membrane protein PEX16Bos taurus (Bovine)9913UniRef100_Q2KII7
UniRef90_Q2KII7
328
E9PP98E9PP98_HUMANPeroxisomal membrane protein PEX16Homo sapiens (Human)9606UniRef100_Q9Y5Y5
UniRef90_Q9Y5Y5
241
A0A2I3LQL1A0A2I3LQL1_PAPANPeroxisomal membrane protein PEX16Papio anubis (Olive baboon)9555UniRef100_A0A2I3LQL1
UniRef90_Q9Y5Y5
346
A0A2J8WFE7A0A2J8WFE7_PONABPeroxisomal membrane protein PEX16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFE7
UniRef90_Q9Y5Y5
346
A0A2J8WFF6A0A2J8WFF6_PONABPeroxisomal membrane protein PEX16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFE7
UniRef90_Q9Y5Y5
181
A0A2J8WFH3A0A2J8WFH3_PONABPeroxisomal membrane protein PEX16 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFE7
UniRef90_Q9Y5Y5
160
G7NDH7G7NDH7_MACMUPeroxisomal membrane protein PEX16Macaca mulatta (Rhesus macaque)9544UniRef100_G7NDH7
UniRef90_Q9Y5Y5
346
G3QIP6G3QIP6_GORGOPeroxisomal membrane protein PEX16Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QIP6
UniRef90_Q9Y5Y5
346
A0A2K5RDS5A0A2K5RDS5_CEBCAPeroxisomal membrane protein PEX16Cebus capucinus imitator1737458UniRef100_A0A2K5RDS5
UniRef90_Q9Y5Y5
346
A0A2J8LHI5A0A2J8LHI5_PANTRPeroxisomal membrane protein PEX16Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LHI5
UniRef90_Q9Y5Y5
346
Q9Y5Y5-2Isoform 2 of PEX16_HUMAN2Homo sapiens (Human)9606UniRef100_Q9Y5Y5-2
UniRef90_Q9Y5Y5
346
E9PLS4E9PLS4_HUMANPeroxisomal membrane protein PEX16 (Fragment)Homo sapiens (Human)9606UniRef100_Q9Y5Y5-2
UniRef90_Q9Y5Y5
160
A0A2K5CY78A0A2K5CY78_AOTNAPeroxisomal membrane protein PEX16Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CY78
UniRef90_Q9Y5Y5
346
A0A4X1SFH4A0A4X1SFH4_PIGPeroxisomal membrane protein PEX16Sus scrofa (Pig)9823UniRef100_A0A4X1SFH4
UniRef90_Q9Y5Y5
342
A0A2J8WFE5A0A2J8WFE5_PONABPeroxisomal membrane protein PEX16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFE5
UniRef90_Q9Y5Y5
336
A0A2J8WFG4A0A2J8WFG4_PONABPeroxisomal membrane protein PEX16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WFE5
UniRef90_Q9Y5Y5
241
A0A2K5RDS7A0A2K5RDS7_CEBCAPeroxisomal membrane protein PEX16Cebus capucinus imitator1737458UniRef100_A0A2K5RDS7
UniRef90_Q9Y5Y5
336
A0A2K5HN24A0A2K5HN24_COLAPPeroxisomal membrane protein PEX16Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HN24
UniRef90_Q9Y5Y5
336
A0A2K5Z996A0A2K5Z996_MANLEPeroxisomal membrane protein PEX16Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Z996
UniRef90_Q9Y5Y5
336
U3DYS8U3DYS8_CALJAPeroxisomal membrane protein PEX16Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3DYS8
UniRef90_Q9Y5Y5
336
A0A2K6RZ29A0A2K6RZ29_SAIBBPeroxisomal membrane protein PEX16Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6RZ29
UniRef90_Q9Y5Y5
336
A0A0D9R006A0A0D9R006_CHLSBPeroxisomal membrane protein PEX16Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R006
UniRef90_Q9Y5Y5
336
H9G207H9G207_MACMUPeroxisomal membrane protein PEX16Macaca mulatta (Rhesus macaque)9544UniRef100_H9G207
UniRef90_Q9Y5Y5
336

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9Y5Y5

Checksumi: 57243AEE0B165C59

FASTA33638,629
        10         20         30         40         50
MEKLRLLGLR YQEYVTRHPA ATAQLETAVR GFSYLLAGRF ADSHELSELV
60 70 80 90 100
YSASNLLVLL NDGILRKELR KKLPVSLSQQ KLLTWLSVLE CVEVFMEMGA
110 120 130 140 150
AKVWGEVGRW LVIALVQLAK AVLRMLLLLW FKAGLQTSPP IVPLDRETQA
160 170 180 190 200
QPPDGDHSPG NHEQSYVGKR SNRVVRTLQN TPSLHSRHWG APQQREGRQQ
210 220 230 240 250
QHHEELSATP TPLGLQETIA EFLYIARPLL HLLSLGLWGQ RSWKPWLLAG
260 270 280 290 300
VVDVTSLSLL SDRKGLTRRE RRELRRRTIL LLYYLLRSPF YDRFSEARIL
310 320 330
FLLQLLADHV PGVGLVTRPL MDYLPTWQKI YFYSWG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again