Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+] n=46 RepID=G1PDH_AERPE MYTSFHRIDLPRTIVVGGGVLDKAGGYVSGVAQRGSYVLVVSGPTVSSKYFERLRASLEA EGLTVGLKIIRDATVETAEEVAREALESRIEVVAGLGGGKSIDVAKYASKRAGSVFVSIP TVASHDGITSPFSSLKGFDKPISRPAKAPEAIIIDVDVIAEAPRRYNIAGFGDLIGKYTA VLDWRLAHKLRLEYYGEYAASLALLSAKHVSQYAEEIALGTREGYRVLLEALVSSGVSMC IAGSTRPASGSEHLFAHALHIVARNKPLHGEAVGVGTIMMAYLHGKNWRRIRGLLKTVGA PTNAKELGVEDDEVVEALTIAARIRPERYTILGEKGLTREAAEALARKTGVI

Members

List component clusters with 100% or 90% identity.
1 to 25 of 46  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9YER2G1PDH_AERPEGlycerol-1-phosphate dehydrogenase [NAD(P)+]Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)272557UniRef100_Q9YER2
UniRef90_Q9YER2
352Representative
A3DN28G1PDH_STAMFGlycerol-1-phosphate dehydrogenase [NAD(P)+]Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)399550UniRef100_A3DN28
UniRef90_A3DN28
355
A8ABP9G1PDH_IGNH4Glycerol-1-phosphate dehydrogenase [NAD(P)+]Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)453591UniRef100_A8ABP9
UniRef90_A8ABP9
352
A2BN26G1PDH_HYPBUGlycerol-1-phosphate dehydrogenase [NAD(P)+]Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)415426UniRef100_A2BN26
UniRef90_A2BN26
349
P58460G1PDH_SULTOGlycerol-1-phosphate dehydrogenase [NAD(P)+]Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii)273063UniRef100_P58460
UniRef90_P58460
350
A0A401H8L6A0A401H8L6_AERPXGlycerol-1-phosphate dehydrogenase [NAD(P)+]Aeropyrum pernix56636UniRef100_A0A401H8L6
UniRef90_Q9YER2
352
U3TEW2U3TEW2_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Aeropyrum camini SY1 = JCM 120911198449UniRef100_U3TEW2
UniRef90_Q9YER2
350
D9Q084D9Q084_ACIS3Glycerol-1-phosphate dehydrogenase [NAD(P)+]Acidilobus saccharovorans (strain DSM 16705 / JCM 18335 / VKM B-2471 / 345-15)666510UniRef100_D9Q084
UniRef90_D9Q084
353
A0A0U2WKF4A0A0U2WKF4_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Ignicoccus islandicus DSM 13165940295UniRef100_A0A0U2WKF4
UniRef90_A0A0U2WKF4
357Seed
A0A2J6XHT3A0A2J6XHT3_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Caldisphaera sp.2060322UniRef100_A0A2J6XHT3
UniRef90_A0A2J6XHT3
352
E0SPF4E0SPF4_IGNAAGlycerol-1-phosphate dehydrogenase [NAD(P)+]Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1)583356UniRef100_E0SPF4
UniRef90_E0SPF4
354
D7DA18D7DA18_STAHDGlycerol-1-phosphate dehydrogenase [NAD(P)+]Staphylothermus hellenicus (strain DSM 12710 / JCM 10830 / BK20S6-10-b1 / P8)591019UniRef100_D7DA18
UniRef90_A3DN28
354
A0A403WND2A0A403WND2_9ZZZZNAD(P)-dependent glycerol-1-phosphate dehydrogenasecompost metagenome702656UniRef100_A3DN28
UniRef90_A3DN28
58
A0A2T9WNR2A0A2T9WNR2_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Sulfolobales archaeon SCGC AB-777_K092005260UniRef100_A0A2T9WNR2
UniRef90_A0A2T9WQJ4
353
A0A2T9X039A0A2T9X039_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Sulfolobales archaeon SCGC AB-777_J032005259UniRef100_A0A2T9X039
UniRef90_A0A2T9WQJ4
353
A0A2T9WQJ4A0A2T9WQJ4_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Sulfolobales archaeon SCGC AB-777_K202005261UniRef100_A0A2T9WQJ4
UniRef90_A0A2T9WQJ4
353
A0A0V8RUA9A0A0V8RUA9_PYROCGlycerol-1-phosphate dehydrogenase [NAD(P)+]Pyrodictium occultum2309UniRef100_A0A0V8RUA9
UniRef90_A0A0V8RUA9
349
E8R7A6E8R7A6_DESM0Glycerol-1-phosphate dehydrogenase [NAD(P)+]Desulfurococcus mucosus (strain ATCC 35584 / DSM 2162 / JCM 9187 / O7/1)765177UniRef100_E8R7A6
UniRef90_E8R7A6
352
A0A256ZJG9A0A256ZJG9_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Desulfurococcales archaeon ex4484_2042012517UniRef100_A0A256ZJG9
UniRef90_A0A256ZJG9
353
V4K5G2V4K5G2_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]uncultured Acidilobus sp. JCHS1410576UniRef100_V4K5G2
UniRef90_V4K5G2
353
A0A2T9X1S0A0A2T9X1S0_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Acidilobus sp. SCGC AC-742_E151987488UniRef100_A0A2T9X1S0
UniRef90_V4K5G2
353
V4K2B8V4K2B8_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]uncultured Acidilobus sp. CIS1410574UniRef100_V4K2B8
UniRef90_V4K5G2
344
V4M4Y0V4M4Y0_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]uncultured Acidilobus sp. OSP81410575UniRef100_V4M4Y0
UniRef90_V4K5G2
338
V4K1V4V4K1V4_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]uncultured Acidilobus sp. MG1410573UniRef100_V4K1V4
UniRef90_V4K5G2
338
D5U317D5U317_THEAMGlycerol-1-phosphate dehydrogenase [NAD(P)+]Thermosphaera aggregans (strain DSM 11486 / M11TL)633148UniRef100_D5U317
UniRef90_D5U317
348

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9YER2

Checksumi: 47E7CA60E02FEDD7

FASTA35237,667
        10         20         30         40         50
MYTSFHRIDL PRTIVVGGGV LDKAGGYVSG VAQRGSYVLV VSGPTVSSKY
60 70 80 90 100
FERLRASLEA EGLTVGLKII RDATVETAEE VAREALESRI EVVAGLGGGK
110 120 130 140 150
SIDVAKYASK RAGSVFVSIP TVASHDGITS PFSSLKGFDK PISRPAKAPE
160 170 180 190 200
AIIIDVDVIA EAPRRYNIAG FGDLIGKYTA VLDWRLAHKL RLEYYGEYAA
210 220 230 240 250
SLALLSAKHV SQYAEEIALG TREGYRVLLE ALVSSGVSMC IAGSTRPASG
260 270 280 290 300
SEHLFAHALH IVARNKPLHG EAVGVGTIMM AYLHGKNWRR IRGLLKTVGA
310 320 330 340 350
PTNAKELGVE DDEVVEALTI AARIRPERYT ILGEKGLTRE AAEALARKTG

VI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again