Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A096MMT5 Protein kinase domain-containing protein n=24 Tax=Simiiformes TaxID=314293 RepID=A0A096MMT5_PAPAN MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPSTTAPRPSS IPAPAEAEAWSPRKLPSSASTLLSPAFPGSQTHSGPELGLVPSPASLRPPPPSPAPSSTK PGPESSVSLLQGAHPSPFCWPLCEISQGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKK LKEDADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG LARFSRFAGSSPSQSSTVARTRTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAA QRAVKTHGARIKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADSWAAPIAMQICKKHLDP RPGPCPPELGLGLGRLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHLEAASCIPP SPQENSYVSSTGGAHSGAAPWQPLAAPSGASAQAAEQLQRGLNQPVESDESLGGLSAALR SWHLTPSCPLGPAPLGEASCPQGDTAGESSWGSGPGFRPTAVEGLVLGSSASSSSEPPQI IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A096MMT5A0A096MMT5_PAPANProtein kinase domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096MMT5
712Representative
G3RR89G3RR89_GORGOInterleukin 1 receptor associated kinase 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RR89
712
A0A2K5P1D9A0A2K5P1D9_CERATProtein kinase domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5P1D9
709
A0A2K6RF11A0A2K6RF11_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF11
703
F6WX15F6WX15_MACMUProtein kinase domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6WX15
690
A0A0D9R3A0A0A0D9R3A0_CHLSBProtein kinase domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R3A0
686
U3BQE8U3BQE8_CALJAInterleukin-1 receptor-associated kinase 1 isoform 2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BQE8
682
F7I281F7I281_CALJAProtein kinase domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7I281
633
A0A2K5Q711A0A2K5Q711_CEBCAProtein kinase domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5Q711
633
A0A2K5DZ31A0A2K5DZ31_AOTNAProtein kinase domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DZ31
632
A0A2K6RF45A0A2K6RF45_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF45
628
A0A2K5IS91A0A2K5IS91_COLAPProtein kinase domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IS91
628
A0A2K6LS94A0A2K6LS94_RHIBEProtein kinase domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LS94
626
A0A2K6RF32A0A2K6RF32_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF32
242
UPI0005F4191Dinterleukin-1 receptor-associated kinase 1 isoform X1Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F4191D
775Seed
UPI0005F47476interleukin-1 receptor-associated kinase 1 isoform X2Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F47476
745
UPI000CEFAA2Cinterleukin-1 receptor-associated kinase 1 isoform X1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_UPI000CEFAA2C
738
UPI00083BF758LOW QUALITY PROTEIN: interleukin-1 receptor-associated kinase 1Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_UPI00083BF758
736
UPI00122D5936interleukin-1 receptor-associated kinase 1 isoform X1Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00122D5936
714
UPI00045E11B7interleukin-1 receptor-associated kinase 1Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R3A0
712
UPI00080A5479interleukin-1 receptor-associated kinase 1 isoform X2Cebus capucinus imitator1737458UniRef100_UPI00080A5479
682
UPI0005F42601interleukin-1 receptor-associated kinase 1 isoform X5Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F42601
682
UPI00122DB324interleukin-1 receptor-associated kinase 1 isoform X2Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_UPI00122DB324
651
UPI0012370FF6interleukin-1 receptor-associated kinase 1 isoform X1Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF32
738

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A096MMT5

Checksumi: 904C4BF61660C518

FASTA71276,281
        10         20         30         40         50
MAGGPGPGEP AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFAALIV
60 70 80 90 100
RDQTELRLCE RSGQRTASVL WPWINRNARV ADLVHILTHL QLLRARDIIT
110 120 130 140 150
AWHPPAPLPS PSTTAPRPSS IPAPAEAEAW SPRKLPSSAS TLLSPAFPGS
160 170 180 190 200
QTHSGPELGL VPSPASLRPP PPSPAPSSTK PGPESSVSLL QGAHPSPFCW
210 220 230 240 250
PLCEISQGTH NFSEELKIGE GGFGCVYRAV MRNTVYAVKK LKEDADLEWT
260 270 280 290 300
AVKQSFLTEV EQLSRFRHPN IVDFAGYCAQ NGFYCLVYGF LPNGSLEDRL
310 320 330 340 350
HCQTQACPPL SWPQRLDILL GTARAIQFLH QDSPSLIHGD IKSSNVLLDE
360 370 380 390 400
RLTPKLGDFG LARFSRFAGS SPSQSSTVAR TRTVRGTLAY LPEEYIKTGR
410 420 430 440 450
LAVDTDTFSF GVVVLETLAA QRAVKTHGAR IKYLKDLVEE EAEEAGVALR
460 470 480 490 500
STQSTLQAGL AADSWAAPIA MQICKKHLDP RPGPCPPELG LGLGRLACCC
510 520 530 540 550
LHRRAKRRPP MTQVYERLEK LQAVVAGVPG HLEAASCIPP SPQENSYVSS
560 570 580 590 600
TGGAHSGAAP WQPLAAPSGA SAQAAEQLQR GLNQPVESDE SLGGLSAALR
610 620 630 640 650
SWHLTPSCPL GPAPLGEASC PQGDTAGESS WGSGPGFRPT AVEGLVLGSS
660 670 680 690 700
ASSSSEPPQI IINPARQKMV QKLALYEDGA LDSLQLLSSS SLPGLGLEQD
710
RQGPEESDEF QS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again