Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A0H5NFA0 Alkane 1-monooxygenase 1 n=19 Tax=Nocardiaceae TaxID=85025 RepID=A0A0H5NFA0_NOCFR MSPWHTASGTDSRGDPKRHLWVLGLIAPASALLPSQLVLRTGWEVFWWVGPIIVLVIIPV LDWLVGEDGTNPRDEDYELLSNDRYYRWCTYLFLPVQLIGLVIAAAMWAGDELSFVDKLG LATTLGLVSGIGINAAHELGHRVEHLERWLAKIALAQSAYGHFFVEHNRGHHVRVATPDD PASARLGESLYEFLPRSVAGGLRSAVALESERLARKGKRWGSPHNHILQAWSMTVVLFGG LMLVFGWQILGWLVLQAVIGAALLETVNYVEHYGLLRERRPDGRWARCSPRDSWNSDRLV TNIFLFHLQRHSDHHANPGRRYQTLRSCDVAPQLPAGYASMIVFAAIPPLWRAVMDHRVL AHYGGDITRANIVPRKRARILAADDRLTRR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 19 of 19  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0H5NFA0A0A0H5NFA0_NOCFRAlkane 1-monooxygenase 1Nocardia farcinica37329UniRef100_A0A0H5NFA0
390Representative
Q5YUH3Q5YUH3_NOCFAPutative alkane-1-monooxygenaseNocardia farcinica (strain IFM 10152)247156UniRef100_Q5YUH3
395Seed
A0A2A7UG82A0A2A7UG82_9NOCAAlkane 1-monooxygenaseNocardia sp. FDAARGOS_3722018066UniRef100_A0A2A7UG82
393
Q5YQS6Q5YQS6_NOCFAPutative alkane-1-monooxygenaseNocardia farcinica (strain IFM 10152)247156UniRef100_Q5YQS6
393
A0A449GEQ7A0A449GEQ7_NOCFRAlkane 1-monooxygenase 1Nocardia farcinica37329UniRef100_A0A449GEQ7
390
A0A379M8P5A0A379M8P5_RHORHAlkane-1-monooxygenaseRhodococcus rhodochrous1829UniRef100_A0A379M8P5
390
A0A2A7UCX5A0A2A7UCX5_9NOCAAlkane 1-monooxygenaseNocardia sp. FDAARGOS_3722018066UniRef100_A0A2A7UCX5
390
A0A0H5P5Q0A0A0H5P5Q0_NOCFRAlkane 1-monooxygenase 1Nocardia farcinica37329UniRef100_A0A0H5P5Q0
376
A0A379M4W7A0A379M4W7_RHORHAlkane-1-monooxygenaseRhodococcus rhodochrous1829UniRef100_A0A379M4W7
376
A0A449H2U5A0A449H2U5_NOCFRAlkane 1-monooxygenase 1Nocardia farcinica37329UniRef100_A0A449H2U5
376
UPI000E1B83C5alkane 1-monooxygenaseRhodococcus rhodochrous1829UniRef100_UPI000E1B83C5
393
UPI0010C9D08Dalkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI0010C9D08D
393
UPI000BF46D99alkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI000BF46D99
390
UPI0007A49BF2alkane 1-monooxygenaseNocardia farcinica37329UniRef100_A0A2A7UCX5
267
UPI000322B084alkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI000322B084
385
UPI00076104F8alkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI00076104F8
385
UPI000BF8D627alkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI000BF8D627
346
UPI000BFA9E4Calkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI000BFA9E4C
346
UPI000970FCF0alkane 1-monooxygenaseNocardia farcinica37329UniRef100_UPI000970FCF0
319

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0H5NFA0

Checksumi: 8ED0806B8EC24BE4

FASTA39043,896
        10         20         30         40         50
MSPWHTASGT DSRGDPKRHL WVLGLIAPAS ALLPSQLVLR TGWEVFWWVG
60 70 80 90 100
PIIVLVIIPV LDWLVGEDGT NPRDEDYELL SNDRYYRWCT YLFLPVQLIG
110 120 130 140 150
LVIAAAMWAG DELSFVDKLG LATTLGLVSG IGINAAHELG HRVEHLERWL
160 170 180 190 200
AKIALAQSAY GHFFVEHNRG HHVRVATPDD PASARLGESL YEFLPRSVAG
210 220 230 240 250
GLRSAVALES ERLARKGKRW GSPHNHILQA WSMTVVLFGG LMLVFGWQIL
260 270 280 290 300
GWLVLQAVIG AALLETVNYV EHYGLLRERR PDGRWARCSP RDSWNSDRLV
310 320 330 340 350
TNIFLFHLQR HSDHHANPGR RYQTLRSCDV APQLPAGYAS MIVFAAIPPL
360 370 380 390
WRAVMDHRVL AHYGGDITRA NIVPRKRARI LAADDRLTRR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again