Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A1X7KKN1 Radical_SAM domain-containing protein n=17 Tax=Paracoccus TaxID=265 RepID=A0A1X7KKN1_9RHOB MGALTLITHNAHRVDVDGHAMLMHVPTTSLFELDAVARDVYDLFRRARAVDAELMRAELG PHHDPETLSECLQSFLALDILRDADAAETPRPVVKVEEIPLSTIILNVNTGCNLACTYCY KEDLTTPAKGQKMGFETARASFELLLKQAHARDRVNVVFFGGEPLSNMPLIREVVAYAEP RAAELGKTVDFSLTTNATLLTPELVDWFDAHRFALTVSMDGPKALHDANRKTVGGKGTYD LVARNVRMLLSRYRSRPVGVRVTLTRGVTDVIGIHDHLKNDLGFHEVGFGPATSGPIAVF NLDAEALKRAFEDMKTLGRRYVEAACKGENIGFSNMHQLLTDIAQGTKKAVPCGAGLGML AVDKDGELHLCHRFVGSNQPTYGNVETGIDIPRLGQFIETAQDRSAYGCKTCRIRSICAG GCYHESYARQGDPFAPVWHYCDLMRDWVDFGIESYVRIMQANPSFFRSQLEPRITRSGPA REVLQ

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1X7KKN1A0A1X7KKN1_9RHOBRadical_SAM domain-containing proteinParacoccus sp. J56935850UniRef100_A0A1X7KKN1
485Representative
Q8VUS9Q8VUS9_PARDERadical_SAM domain-containing proteinParacoccus denitrificans266UniRef100_Q8VUS9
485Seed
A0A454NH35A0A454NH35_PARPNQuinohemoprotein amine dehydrogenase maturation proteinParacoccus pantotrophus (Thiosphaera pantotropha)82367UniRef100_A0A454NH35
485
A0A4Y8P517A0A4Y8P517_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus sp. DMF400837UniRef100_A0A4Y8P517
485
A1B2Q7A1B2Q7_PARDPRadical SAM domain proteinParacoccus denitrificans (strain Pd 1222)318586UniRef100_A1B2Q7
485
A0A3N7GGQ0A0A3N7GGQ0_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus sp. BP82305219UniRef100_A0A3N7GGQ0
485
A0A495NXI8A0A495NXI8_PARPNRadical_SAM domain-containing proteinParacoccus pantotrophus (Thiosphaera pantotropha)82367UniRef100_A0A495NXI8
485
A0A0V0PW34A0A0V0PW34_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus sp. MKU11745182UniRef100_A0A0V0PW34
485
A0A386US46A0A386US46_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus yeei147645UniRef100_A0A386US46
484
A0A1V0GN61A0A1V0GN61_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus yeei147645UniRef100_A0A1V0GN61
484
A0A2D2C5N4A0A2D2C5N4_9RHOBQuinohemoprotein amine dehydrogenase maturation proteinParacoccus yeei147645UniRef100_A0A2D2C5N4
484
UPI000CEC2D38quinohemoprotein amine dehydrogenase maturation proteinParacoccus denitrificans266UniRef100_UPI000CEC2D38
485
UPI0007835326quinohemoprotein amine dehydrogenase maturation proteinParacoccus aminovorans34004UniRef100_UPI0007835326
485
UPI000225F0B9quinohemoprotein amine dehydrogenase maturation proteinParacoccus sp. TRP412597UniRef100_UPI000225F0B9
485
UPI00048BD5C3quinohemoprotein amine dehydrogenase maturation proteinunclassified Paracoccus246570UniRef100_UPI00048BD5C3
485
UPI00037EC1E5quinohemoprotein amine dehydrogenase maturation proteinParacoccus sp. N51101189UniRef100_UPI00037EC1E5
485
UPI00048EB4FFquinohemoprotein amine dehydrogenase maturation proteinParacoccus yeei147645UniRef100_UPI00048EB4FF
484

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1X7KKN1

Checksumi: 3E57ED9692E62B15

FASTA48553,651
        10         20         30         40         50
MGALTLITHN AHRVDVDGHA MLMHVPTTSL FELDAVARDV YDLFRRARAV
60 70 80 90 100
DAELMRAELG PHHDPETLSE CLQSFLALDI LRDADAAETP RPVVKVEEIP
110 120 130 140 150
LSTIILNVNT GCNLACTYCY KEDLTTPAKG QKMGFETARA SFELLLKQAH
160 170 180 190 200
ARDRVNVVFF GGEPLSNMPL IREVVAYAEP RAAELGKTVD FSLTTNATLL
210 220 230 240 250
TPELVDWFDA HRFALTVSMD GPKALHDANR KTVGGKGTYD LVARNVRMLL
260 270 280 290 300
SRYRSRPVGV RVTLTRGVTD VIGIHDHLKN DLGFHEVGFG PATSGPIAVF
310 320 330 340 350
NLDAEALKRA FEDMKTLGRR YVEAACKGEN IGFSNMHQLL TDIAQGTKKA
360 370 380 390 400
VPCGAGLGML AVDKDGELHL CHRFVGSNQP TYGNVETGID IPRLGQFIET
410 420 430 440 450
AQDRSAYGCK TCRIRSICAG GCYHESYARQ GDPFAPVWHY CDLMRDWVDF
460 470 480
GIESYVRIMQ ANPSFFRSQL EPRITRSGPA REVLQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again