Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A2I3NDD8 MYND-type domain-containing protein n=31 Tax=Simiiformes TaxID=314293 RepID=A0A2I3NDD8_PAPAN MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPRALACALCGRPLSF LLQVYAPLPGRADAFHRGIFLFCCREPPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQTCAQPDHFDH IIPDHNFLFPEFEIVIETEEEIMPEVVEKEDYSEITGSMGI

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 31  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2I3NDD8A0A2I3NDD8_PAPANMYND-type domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3NDD8
221Representative
K7B287K7B287_PANTRPDCD2 isoform 8Pan troglodytes (Chimpanzee)9598UniRef100_K7B287
228
Q16342-4Isoform 4 of PDCD2_HUMAN4Homo sapiens (Human)9606UniRef100_K7B287
228
A0A2I3MKJ3A0A2I3MKJ3_PAPANMYND-type domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MKJ3
224
A0A2K6CBX4A0A2K6CBX4_MACNEMYND-type domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CBX4
224
A0A1D5QJR5A0A1D5QJR5_MACMUMYND-type domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QJR5
224
A0A2K5LUN8A0A2K5LUN8_CERATMYND-type domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LUN8
224
A0A2K5LUN7A0A2K5LUN7_CERATMYND-type domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LUN7
221
A0A2J8SA29A0A2J8SA29_PONABPDCD2 isoform 5Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8SA29
221
A0A2K6CBX1A0A2K6CBX1_MACNEMYND-type domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CBX1
221
J3QK82J3QK82_HUMANProgrammed cell death 2, isoform CRA_aHomo sapiens (Human)9606UniRef100_J3QK82
221
A0A2J8IL75A0A2J8IL75_PANTRPDCD2 isoform 5Pan troglodytes (Chimpanzee)9598UniRef100_J3QK82
221
A0A2J8SA42A0A2J8SA42_PONABPDCD2 isoform 14Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8SA42
221
A0A2I3G1F7A0A2I3G1F7_NOMLEMYND-type domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3G1F7
221
A0A2K5V3N0A0A2K5V3N0_MACFAMYND-type domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5V3N0
221
A0A087WYJ3A0A087WYJ3_HUMANProgrammed cell death protein 2Homo sapiens (Human)9606UniRef100_A0A087WYJ3
221
A0A2I3SIU4A0A2I3SIU4_PANTRPDCD2 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A087WYJ3
221
A0A2K5QRZ2A0A2K5QRZ2_CEBCAMYND-type domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5QRZ2
220
A0A2K5CTH3A0A2K5CTH3_AOTNAMYND-type domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CTH3
218
A0A2J8IL82A0A2J8IL82_PANTRPDCD2 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8IL82
195
Q16342-2Isoform 2 of PDCD2_HUMAN2Homo sapiens (Human)9606UniRef100_A0A2J8IL82
195
UPI0005F4B7D0programmed cell death protein 2 isoform X2Macaca nemestrina (Pig-tailed macaque)9545UniRef100_UPI0005F4B7D0
239Seed
UPI00083F0DAAprogrammed cell death protein 2 isoform X2Papio anubis (Olive baboon)9555UniRef100_UPI00083F0DAA
239
UPI0005F557E1programmed cell death protein 2 isoform X2Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_UPI0005F557E1
239
UPI00075FAF7Bprogrammed cell death protein 2 isoform X2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_UPI00075FAF7B
239

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2I3NDD8

Checksumi: 9425A0026EE43C1B

FASTA22124,534
        10         20         30         40         50
MAAAGARPVE LGFAESAPAW RLRSEQFPSK VGGRPAWLGA AGLPGPRALA
60 70 80 90 100
CALCGRPLSF LLQVYAPLPG RADAFHRGIF LFCCREPPCC AGLRVFRNQL
110 120 130 140 150
PRKNDFYSYE PPSENPPPET GESVCLQLKS GAHLCRVCGC LGPKTCSRCH
160 170 180 190 200
KAYYCSKEHQ TLDWRLGHKQ TCAQPDHFDH IIPDHNFLFP EFEIVIETEE
210 220
EIMPEVVEKE DYSEITGSMG I
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again