Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A2K5I665 F-box domain-containing protein n=26 Tax=Eutheria TaxID=9347 RepID=A0A2K5I665_COLAP MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS TCYSLSRFCSKLKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLT DASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLS IHCPQLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCRGL ERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 26  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5I665A0A2K5I665_COLAPF-box domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5I665
355Representative
L5L2L4L5L2L4_PTEALF-box/LRR-repeat protein 2 (Fragment)Pteropus alecto (Black flying fox)9402UniRef100_L5L2L4
385
D2HAZ8D2HAZ8_AILMEUncharacterized protein (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_D2HAZ8
360
A0A340WGH4A0A340WGH4_LIPVEF-box/LRR-repeat protein 2 isoform X2Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340WGH4
355
A0A4W2BVA1A0A4W2BVA1_BOBOXF-box domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2BVA1
355
A0A2U3Y1U8A0A2U3Y1U8_LEPWEF-box/LRR-repeat protein 2 isoform X2Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3Y1U8
355
A0A2J8WYQ3A0A2J8WYQ3_PONABFBXL2 isoform 10Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8WYQ3
355
A0A2J8NPW9A0A2J8NPW9_PANTRF-box and leucine rich repeat protein 2Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8WYQ3
355
A0A2K6R3Q2A0A2K6R3Q2_RHIROF-box domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2J8WYQ3
355
A0A1D5QH46A0A1D5QH46_MACMUF-box domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A2J8WYQ3
355
A0A2I3M031A0A2I3M031_PAPANF-box domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2J8WYQ3
355
A0A2I3GQE0A0A2I3GQE0_NOMLEF-box domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2J8WYQ3
355
Q9UKC9-2Isoform 2 of FBXL2_HUMAN2Homo sapiens (Human)9606UniRef100_A0A2J8WYQ3
355
A0A2K5Z9I3A0A2K5Z9I3_MANLEF-box domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2J8WYQ3
354
A0A2K6KHL7A0A2K6KHL7_RHIBEF-box domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KHL7
354
UPI000D53715CF-box/LRR-repeat protein 2 isoform X1Pteropus alecto (Black flying fox)9402UniRef100_UPI000D53715C
436Seed
UPI000787FBB2F-box/LRR-repeat protein 2 isoform X1Rousettus aegyptiacus (Egyptian rousette) (Egyptian fruit bat)9407UniRef100_UPI000787FBB2
423
UPI00018B49FDF-box/LRR-repeat protein 2 isoform X2Pteropus alecto (Black flying fox)9402UniRef100_UPI00018B49FD
423
UPI0007870055F-box/LRR-repeat protein 2 isoform X2Rousettus aegyptiacus (Egyptian rousette) (Egyptian fruit bat)9407UniRef100_UPI0007870055
414
UPI000C87D6EEF-box/LRR-repeat protein 2Pteropus vampyrus (Large flying fox)132908UniRef100_UPI000C87D6EE
400
UPI0010F512A0F-box/LRR-repeat protein 2 isoform X2Monodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_UPI0010F512A0
355
UPI0003F12CE7F-box/LRR-repeat protein 2 isoform X2Chrysochloris asiatica (Cape golden mole)185453UniRef100_UPI0003F12CE7
355
UPI00063F2D05F-box/LRR-repeat protein 2 isoform X3Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_UPI00063F2D05
355
UPI000625E80EF-box/LRR-repeat protein 2 isoform X2Aotus nancymaae (Ma's night monkey)37293UniRef100_UPI000625E80E
351
UPI000809B777F-box/LRR-repeat protein 2 isoform X2Cebus capucinus imitator1737458UniRef100_UPI000809B777
351

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5I665

Checksumi: 4C751680AB637C10

FASTA35539,613
        10         20         30         40         50
MVFSNNDEGL INKKLPKELL LRIFSFLDIV TLCRCAQISK AWNILALDGS
60 70 80 90 100
NWQRIDLFNF QTDVEGRVVE NISKRCGGFL RKLSLRGCIG VGDSSLKTFA
110 120 130 140 150
QNCRNIEHLN LNGCTKITDS TCYSLSRFCS KLKHIQNYCH ELVSLNLQSC
160 170 180 190 200
SRITDEGVVQ ICRGCHRLQA LCLSGCSNLT DASLTALGLN CPRLQILEAA
210 220 230 240 250
RCSHLTDAGF TLLARNCHEL EKMDLEECIL ITDSTLIQLS IHCPQLQALS
260 270 280 290 300
LSHCELITDD GILHLSNSTC GHERLRVLEL DNCLLITDVA LEHLENCRGL
310 320 330 340 350
ERLELYDCQQ VTRAGIKRMR AQLPHVKVHA YFAPVTPPTA VAGSGQRLCR

CCVIL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again