Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A2K5Q2M9 Carn_acyltransf domain-containing protein n=4 Tax=Simiiformes TaxID=314293 RepID=A0A2K5Q2M9_CEBCA MENQLTKSNEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANEEEYKKTEEIVHKFQS GIGKKLHQKLLERAKGKRNWVFVVIIEK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5Q2M9A0A2K5Q2M9_CEBCACarn_acyltransf domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5Q2M9
88Representative & Seed
A0A2J8LGK6A0A2J8LGK6_PANTRCROT isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LGK6
87
Q9UKG9-2Isoform 2 of OCTC_HUMAN2Homo sapiens (Human)9606UniRef100_A0A2J8LGK6
87
A0A2J8VLR4A0A2J8VLR4_PONABCROT isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VLR4
87

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5Q2M9

Checksumi: 2EA0E71C6B477C63

FASTA8810,394
        10         20         30         40         50
MENQLTKSNE ERTFQYQDSL PSLPVPSLEE SLKKYLESVK PFANEEEYKK
60 70 80
TEEIVHKFQS GIGKKLHQKL LERAKGKRNW VFVVIIEK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again