Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A2K6UEN1 Dishevelled segment polarity protein 1 n=16 Tax=Simiiformes TaxID=314293 RepID=A0A2K6UEN1_SAIBB VVKEEILDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRP PSFHPNVASSRDGVDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDS TSTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKYASSLLKHGFLRHTVNKIT FSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPTAPWPLGQGYPYQYPGPPPC FPPAYQDPGFSYGSGSTGSQQSEGSRSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTA PSGVGSSWRECPAGQLSRGSSPRSQASSTAPGLPTPHPVTKAYTVVGGPPGGPPVRELAA VPPELTGSRQSFQKAMGNPCEFFVDIM

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 16 of 16  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K6UEN1A0A2K6UEN1_SAIBBDishevelled segment polarity protein 1Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6UEN1
387Representative
F7DYF0F7DYF0_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7DYF0
473Seed
A0A2K6DKR4A0A2K6DKR4_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DKR4
451
A0A2I3LRR5A0A2I3LRR5_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LRR5
449
A0A2K5V9Q8A0A2K5V9Q8_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5V9Q8
449
A0A2K5LWP6A0A2K5LWP6_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5V9Q8
449
A0A2J8IRS4A0A2J8IRS4_PANTRDVL1 isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8IRS4
444
Q86TH3Q86TH3_HUMANDishevelled, dsh homolog 1 (Drosophila)Homo sapiens (Human)9606UniRef100_Q86TH3
444
A0A087WWA7A0A087WWA7_HUMANSegment polarity protein dishevelled homolog DVL-1Homo sapiens (Human)9606UniRef100_A0A087WWA7
444
A0A2J8R7D2A0A2J8R7D2_PONABDVL1 isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8R7D2
444
A0A2K5HI30A0A2K5HI30_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HI30
443
A0A2I3S591A0A2I3S591_PANTRSegment polarity protein dishevelled homolog DVL-1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3S591
440
A0A2I2YGI1A0A2I2YGI1_GORGODishevelled segment polarity protein 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YGI1
440
A0A2K5DQT1A0A2K5DQT1_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DQT1
439
A0A2K5SFZ5A0A2K5SFZ5_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5SFZ5
439
A0A2K5XX00A0A2K5XX00_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XX00
387

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K6UEN1

Checksumi: 0B21752613B5A88A

FASTA38740,953
        10         20         30         40         50
VVKEEILDDN AKLPCFNGRV VSWLVLAEGA HSDAGSQGTD SHTDLPPPLE
60 70 80 90 100
RTGGIGDSRP PSFHPNVASS RDGVDNETGT ESMVSHRRER ARRRNREEAA
110 120 130 140 150
RTNGHPRGDR RRDVGLPPDS TSTALSSELE SSSFVDSDED GSTSRLSSST
160 170 180 190 200
EQSTSSRLIR KYASSLLKHG FLRHTVNKIT FSEQCYYVFG DLCSNLAALN
210 220 230 240 250
LNSGSSGASD QDTLAPLPHP TAPWPLGQGY PYQYPGPPPC FPPAYQDPGF
260 270 280 290 300
SYGSGSTGSQ QSEGSRSSGS TRSSRRAPGR EKERRAAGAG GSGSESDHTA
310 320 330 340 350
PSGVGSSWRE CPAGQLSRGS SPRSQASSTA PGLPTPHPVT KAYTVVGGPP
360 370 380
GGPPVRELAA VPPELTGSRQ SFQKAMGNPC EFFVDIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again