Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A337SKA0 Uncharacterized protein n=14 Tax=Boreoeutheria TaxID=1437010 RepID=A0A337SKA0_FELCA MASGSTASDEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEE AKQIQNLQKASARADSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKD YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGE MDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLR KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAA VLQRRSENEEFVEGCSAFWFRLSHCHHMSVSRSV

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 14 of 14  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A337SKA0A0A337SKA0_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A337SKA0
334Representative
W5Q084W5Q084_SHEEPUncharacterized proteinOvis aries (Sheep)9940UniRef100_W5Q084
411Seed
A0A212DB29A0A212DB29_CEREHPRKAR1A (Fragment)Cervus elaphus hippelaphus (European red deer)46360UniRef100_W5Q084
235
F7BR24F7BR24_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7BR24
337
A0A2K5XAQ3A0A2K5XAQ3_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_F7BR24
337
A0A2J8V099A0A2J8V099_PONABPRKAR1A isoform 18Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8V099
337
A0A2I2Y425A0A2I2Y425_GORGOProtein kinase cAMP-dependent type I regulatory subunit alphaGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Y425
337
A0A2K6V5W0A0A2K6V5W0_SAIBBProtein kinase cAMP-dependent type I regulatory subunit alphaSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6V5W0
337
F7H8N1F7H8N1_CALJAUncharacterized proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7H8N1
337
A0A2I3RGR9A0A2I3RGR9_PANTRPRKAR1A isoform 18Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RGR9
337
A0A2R9AX54A0A2R9AX54_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3RGR9
337
P10644-2Isoform 2 of KAP0_HUMAN2Homo sapiens (Human)9606UniRef100_A0A2I3RGR9
337
A0A2K5QVE5A0A2K5QVE5_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5QVE5
331
UPI000069760CcAMP-dependent protein kinase type I-alpha regulatory subunitBos taurus (Bovine)9913UniRef100_W5Q084
50

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A337SKA0

Checksumi: 64B919A95FEA97C8

FASTA33437,852
        10         20         30         40         50
MASGSTASDE ERSLRECELY VQKHNIQALL KDSIVQLCTA RPERPMAFLR
60 70 80 90 100
EYFERLEKEE AKQIQNLQKA SARADSREDE ISPPPPNPVV KGRRRRGAIS
110 120 130 140 150
AEVYTEEDAA SYVRKVIPKD YKTMAALAKA IEKNVLFSHL DDNERSDIFD
160 170 180 190 200
AMFPVSFIAG ETVIQQGDEG DNFYVIDQGE MDVYVNNEWA TSVGEGGSFG
210 220 230 240 250
ELALIYGTPR AATVKAKTNV KLWGIDRDSY RRILMGSTLR KRKMYEEFLS
260 270 280 290 300
KVSILESLDK WERLTVADAL EPVQFEDGQK IVVQGEPGDE FFIILEGSAA
310 320 330
VLQRRSENEE FVEGCSAFWF RLSHCHHMSV SRSV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again