Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0A3B4AT74 Superoxide dismutase [Cu-Zn] n=3 Tax=Periophthalmus magnuspinnatus TaxID=409849 RepID=A0A3B4AT74_9GOBI MVVKAVCVLKGAGETTGVVHFKQEGDSAPVEITGEIKGLTPGKHGFHVHAFGDNTNGCIS AGPHFNPHNKNHAGPTDEERHVGDLGNVTAGADNVAKIEITDKVISLVGPHSIIGRTMVI HEGTDDLGKGGNEESLKTGNAGGRLACGVIGIAQ

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A3B4AT74A0A3B4AT74_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4AT74
154Representative & Seed
A0A3B4AWF0A0A3B4AWF0_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4AWF0
142
A0A3B4ATR2A0A3B4ATR2_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4ATR2
140

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A3B4AT74

Checksumi: 8615AB10DD4E52EE

FASTA15415,786
        10         20         30         40         50
MVVKAVCVLK GAGETTGVVH FKQEGDSAPV EITGEIKGLT PGKHGFHVHA
60 70 80 90 100
FGDNTNGCIS AGPHFNPHNK NHAGPTDEER HVGDLGNVTA GADNVAKIEI
110 120 130 140 150
TDKVISLVGP HSIIGRTMVI HEGTDDLGKG GNEESLKTGN AGGRLACGVI

GIAQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again