Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A0JLT2 Mediator of RNA polymerase II transcription subunit 19 n=89 Tax=Eutheria TaxID=9347 RepID=MED19_HUMAN MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGA GCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG SHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHK QSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSS SSLR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 89  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0JLT2MED19_HUMANMediator of RNA polymerase II transcription subunit 19Homo sapiens (Human)9606UniRef100_A0JLT2
244Representative
Q8C1S0MED19_MOUSEMediator of RNA polymerase II transcription subunit 19Mus musculus (Mouse)10090UniRef100_Q8C1S0
244
A0A2R8MVW7A0A2R8MVW7_CALJAMediator of RNA polymerase II transcription subunit 19Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MVW7
261
A0A2Y9GMU0A0A2Y9GMU0_NEOSCMediator of RNA polymerase II transcription subunit 19Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9GMU0
261
G3RN27G3RN27_GORGOMediator of RNA polymerase II transcription subunit 19Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RN27
261
F7BFP8F7BFP8_HORSEMediator of RNA polymerase II transcription subunit 19Equus caballus (Horse)9796UniRef100_F7BFP8
261
A0A2K6S169A0A2K6S169_SAIBBMediator of RNA polymerase II transcription subunit 19Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6S169
261
M3XMH4M3XMH4_MUSPFMediator of RNA polymerase II transcription subunit 19Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3XMH4
261
A0A2Y9JMN9A0A2Y9JMN9_ENHLUMediator of RNA polymerase II transcription subunit 19Enhydra lutris kenyoni391180UniRef100_M3XMH4
261
G9KA61G9KA61_MUSPFMediator of RNA polymerase II transcription subunit 19 (Fragment)Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3XMH4
252
U6DFW7U6DFW7_NEOVIMediator of RNA polymerase II transcription subunit 19 (Fragment)Neovison vison (American mink) (Mustela vison)452646UniRef100_M3XMH4
163
H2NDF3H2NDF3_PONABMediator of RNA polymerase II transcription subunit 19Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NDF3
261
G7ND98G7ND98_MACMUMediator of RNA polymerase II transcription subunit 19Macaca mulatta (Rhesus macaque)9544UniRef100_H2NDF3
244
G7PQ29G7PQ29_MACFAMediator of RNA polymerase II transcription subunit 19Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_H2NDF3
244
A0A341BTM3A0A341BTM3_9CETAMediator of RNA polymerase II transcription subunit 19Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341BTM3
261
A0A4U1F978A0A4U1F978_MONMOMediator of RNA polymerase II transcription subunit 19Monodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_A0A4U1F978
261
A0A2U3V1I3A0A2U3V1I3_TURTRMediator of RNA polymerase II transcription subunit 19Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A4U1F978
261
A0A2Y9PX12A0A2Y9PX12_DELLEMediator of RNA polymerase II transcription subunit 19Delphinapterus leucas (Beluga whale)9749UniRef100_A0A4U1F978
261
A0A340X368A0A340X368_LIPVEMediator of RNA polymerase II transcription subunit 19Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A4U1F978
244
A0A383ZDF0A0A383ZDF0_BALASMediator of RNA polymerase II transcription subunit 19Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A4U1F978
171
A0A3Q7R183A0A3Q7R183_CALURMediator of RNA polymerase II transcription subunit 19Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7R183
261
A0A2K6FLI3A0A2K6FLI3_PROCOMediator of RNA polymerase II transcription subunit 19Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FLI3
261
L9J964L9J964_TUPCHMediator of RNA polymerase II transcription subunit 19Tupaia chinensis (Chinese tree shrew)246437UniRef100_L9J964
261
A0A494C0Y4A0A494C0Y4_HUMANMediator of RNA polymerase II transcription subunit 19Homo sapiens (Human)9606UniRef100_A0A494C0Y4
261
J3KR33J3KR33_HUMANMediator of RNA polymerase II transcription subunit 19Homo sapiens (Human)9606UniRef100_A0A494C0Y4
244

Sequence

Representative sequenceiLengthMass (Da)Tools
A0JLT2

Checksumi: 9B85721364F33F02

FASTA24426,273
        10         20         30         40         50
MENFTALFGA QADPPPPPTA LGFGPGKPPP PPPPPAGGGP GTAPPPTAAT
60 70 80 90 100
APPGADKSGA GCGPFYLMRE LPGSTELTGS TNLITHYNLE QAYNKFCGKK
110 120 130 140 150
VKEKLSNFLP DLPGMIDLPG SHDNSSLRSL IEKPPILSSS FNPITGTMLA
160 170 180 190 200
GFRLHTGPLP EQCRLMHIQP PKKKNKHKHK QSRTQDPVPP ETPSDSDHKK
210 220 230 240
KKKKKEEDPD RKRKKKEKKK KKNRHSPDHP GMGSSQASSS SSLR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again