Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A1JTL6 Argininosuccinate synthase n=93 Tax=Proteobacteria TaxID=1224 RepID=ASSY_YERE8 MTTILKHLPINQRVGIAFSGGLDTSAALLWMQKKGAIPYAYTANLGQPDEEDYDAIPRKA MEYGAEKARLIDCRKQLVAEGIAAIQCGAFHNTTAGVTYFNTTPLGRAVTGTMLVAAMKE DGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFIDELGGRHEMSEFMIQSG FDYKMSTEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDENVVVKAEEVSVR FERGYPVALNGVVFDDSVELMMEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL HIAYERLLTGIHNEDTIEQYHANGRVLGRLLYQGRWFDPQALMLRDSAQRWVASEITGEV TLELRRGNDYSILNTVSENLTYQPERLTMEKGDSVFSPDDRIGQLTMRNLDITDTRKKLF SYATTGLLSASAEVGLPQVDNNNLTARGLQDKSK

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 93  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A1JTL6ASSY_YERE8Argininosuccinate synthaseYersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)393305UniRef100_A1JTL6
454Representative
A7FJE9ASSY_YERP3Argininosuccinate synthaseYersinia pseudotuberculosis serotype O:1b (strain IP 31758)349747UniRef100_A7FJE9
455Seed
B2JZQ2ASSY_YERPBArgininosuccinate synthaseYersinia pseudotuberculosis serotype IB (strain PB1/+)502801UniRef100_A7FJE9
455
Q8ZFV7ASSY_YERPEArgininosuccinate synthaseYersinia pestis632UniRef100_A7FJE9
455
A9R622ASSY_YERPGArgininosuccinate synthaseYersinia pestis bv. Antiqua (strain Angola)349746UniRef100_A7FJE9
455
Q1CGZ2ASSY_YERPNArgininosuccinate synthaseYersinia pestis bv. Antiqua (strain Nepal516)377628UniRef100_A7FJE9
455
A4TKI3ASSY_YERPPArgininosuccinate synthaseYersinia pestis (strain Pestoides F)386656UniRef100_A7FJE9
455
Q66C31ASSY_YERPSArgininosuccinate synthaseYersinia pseudotuberculosis serotype I (strain IP32953)273123UniRef100_A7FJE9
455
B1JPT9ASSY_YERPYArgininosuccinate synthaseYersinia pseudotuberculosis serotype O:3 (strain YPIII)502800UniRef100_A7FJE9
455
A0A3S4IT25A0A3S4IT25_YERENArgininosuccinate synthaseYersinia enterocolitica subsp. enterocolitica150052UniRef100_A1JTL6
454
A0A0H5K9D4A0A0H5K9D4_YERENArgininosuccinate synthaseYersinia enterocolitica630UniRef100_A1JTL6
454
A0A0H3NYV2A0A0H3NYV2_YERE1Argininosuccinate synthaseYersinia enterocolitica subsp. palearctica serotype O:3 (strain DSM 13030 / CIP 106945 / Y11)930944UniRef100_A1JTL6
454
A0A2R9T9P0A0A2R9T9P0_YERENArgininosuccinate synthaseYersinia enterocolitica subsp. palearctica YE-P41329364UniRef100_A1JTL6
454
A0A0T9LMK6A0A0T9LMK6_YERPUArgininosuccinate synthaseYersinia pseudotuberculosis633UniRef100_A7FJE9
455
A0A3N4B712A0A3N4B712_YERPEArgininosuccinate synthaseYersinia pestis632UniRef100_A7FJE9
455
A0A0M1V3S5A0A0M1V3S5_YERPEArgininosuccinate synthaseYersinia pestis biovar Orientalis str. IP275373665UniRef100_A7FJE9
455
A0A0T9NX46A0A0T9NX46_9GAMMArgininosuccinate synthaseYersinia similis367190UniRef100_A7FJE9
455
A0A0U1ERQ8A0A0U1ERQ8_YERINArgininosuccinate synthaseYersinia intermedia631UniRef100_A7FJE9
455
A0A0T9JAI8A0A0T9JAI8_YERPUArgininosuccinate synthaseYersinia pseudotuberculosis633UniRef100_A0A0T9JAI8
455
A0A0E8XCL6A0A0E8XCL6_9GAMMArgininosuccinate synthaseYersinia wautersii1341643UniRef100_A0A0E8XCL6
455
A0A2N0VX20A0A2N0VX20_9GAMMArgininosuccinate synthaseRahnella sp. AA2057180UniRef100_A0A2N0VX20
454
A0A0U1HLM3A0A0U1HLM3_YERENArgininosuccinate synthaseYersinia enterocolitica630UniRef100_A0A0U1HLM3
454
A0A0U1HS62A0A0U1HS62_YERROArgininosuccinate synthaseYersinia rohdei29485UniRef100_A0A0U1HS62
454
C4S865C4S865_YERMWArgininosuccinate synthaseYersinia mollaretii (strain ATCC 43969 / DSM 18520 / CIP 103324 / CNY 7263 / WAIP 204)349967UniRef100_C4S865
454
A0A0T9LX85A0A0T9LX85_YERINArgininosuccinate synthaseYersinia intermedia631UniRef100_A0A0T9LX85
454

Sequence

Representative sequenceiLengthMass (Da)Tools
A1JTL6

Checksumi: FE877449446A1EC7

FASTA45450,708
        10         20         30         40         50
MTTILKHLPI NQRVGIAFSG GLDTSAALLW MQKKGAIPYA YTANLGQPDE
60 70 80 90 100
EDYDAIPRKA MEYGAEKARL IDCRKQLVAE GIAAIQCGAF HNTTAGVTYF
110 120 130 140 150
NTTPLGRAVT GTMLVAAMKE DGVNIWGDGS TYKGNDIERF YRYGLLTNAE
160 170 180 190 200
LKIYKPWLDT DFIDELGGRH EMSEFMIQSG FDYKMSTEKA YSTDSNMLGA
210 220 230 240 250
THEAKDLEFL NSSVKIVNPI MGVKFWDENV VVKAEEVSVR FERGYPVALN
260 270 280 290 300
GVVFDDSVEL MMEANRIGGR HGLGMSDQIE NRIIEAKSRG IYEAPGMALL
310 320 330 340 350
HIAYERLLTG IHNEDTIEQY HANGRVLGRL LYQGRWFDPQ ALMLRDSAQR
360 370 380 390 400
WVASEITGEV TLELRRGNDY SILNTVSENL TYQPERLTME KGDSVFSPDD
410 420 430 440 450
RIGQLTMRNL DITDTRKKLF SYATTGLLSA SAEVGLPQVD NNNLTARGLQ

DKSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again