Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A2C4Y4 50S ribosomal protein L18 n=7 Tax=Prochlorococcus TaxID=1218 RepID=RL18_PROM1 MSKLSRKQQTQKRHKRLRRNLSGTESRPRLAVFRSNNHIYAQIIDDDAQNTICAASTLDK DLKASLKVNAGSCDASTAVGELVAKKALSKGIKQVIFDRGGNIYHGRVKALAEAARVAGL NF

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 7 of 7  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A2C4Y4RL18_PROM150S ribosomal protein L18Prochlorococcus marinus (strain NATL1A)167555UniRef100_A2C4Y4
122Representative & Seed
Q46IS4RL18_PROMT50S ribosomal protein L18Prochlorococcus marinus (strain NATL2A)59920UniRef100_A2C4Y4
122
A0A0D5A3R0A0A0D5A3R0_PROMR50S ribosomal protein L18Prochlorococcus marinus str. P0902-H2121620696UniRef100_A2C4Y4
122
A0A0D5A3I2A0A0D5A3I2_PROMR50S ribosomal protein L18Prochlorococcus marinus str. P0903-H2121622208UniRef100_A0A0D5A3I2
122
A0A089QUF4A0A089QUF4_9PROC50S ribosomal protein L18Prochlorococcus sp. MIT 08011501269UniRef100_A0A089QUF4
122
A0A318R086A0A318R086_PROMR50S ribosomal protein L18Prochlorococcus marinus XMU14082213228UniRef100_A0A318R086
122
A0A0A2C916A0A0A2C916_PROMR50S ribosomal protein L18Prochlorococcus marinus str. PAC159924UniRef100_A0A0A2C916
122

Sequence

Representative sequenceiLengthMass (Da)Tools
A2C4Y4

Checksumi: 9D65371C4E2F5EF0

FASTA12213,349
        10         20         30         40         50
MSKLSRKQQT QKRHKRLRRN LSGTESRPRL AVFRSNNHIY AQIIDDDAQN
60 70 80 90 100
TICAASTLDK DLKASLKVNA GSCDASTAVG ELVAKKALSK GIKQVIFDRG
110 120
GNIYHGRVKA LAEAARVAGL NF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again