Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A3N376 50S ribosomal protein L15 n=50 Tax=Pasteurellaceae TaxID=712 RepID=RL15_ACTP2 MRLNSLSPAEGAKHSAKRLGRGIGSGLGKTGGRGHKGQKSRTGGGVRRGFEGGQMPLYRR LPKFGFTSLKSFHVAEIRLNDLAKVDGNEVTLESLKAANVITKDILSVKVILAGKIEKAV VVKGLGVTKGAKAAIEAAGGSIEE

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 25 of 50  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A3N376RL15_ACTP250S ribosomal protein L15Actinobacillus pleuropneumoniae serotype 5b (strain L20)416269UniRef100_A3N376
144Representative & Seed
B0BSV0RL15_ACTPJ50S ribosomal protein L15Actinobacillus pleuropneumoniae serotype 3 (strain JL03)434271UniRef100_A3N376
144
Q7VKF2RL15_HAEDU50S ribosomal protein L15Haemophilus ducreyi (strain 35000HP / ATCC 700724)233412UniRef100_Q7VKF2
144
B3GZ30RL15_ACTP750S ribosomal protein L15Actinobacillus pleuropneumoniae serotype 7 (strain AP76)537457UniRef100_B3GZ30
144
B8F6Q2RL15_HAEPS50S ribosomal protein L15Haemophilus parasuis serovar 5 (strain SH0165) (Glaesserella parasuis)557723UniRef100_B8F6Q2
144
A0A2X3Y866A0A2X3Y866_ACTPL50S ribosomal protein L15Actinobacillus pleuropneumoniae (Haemophilus pleuropneumoniae)715UniRef100_A3N376
144
A0A380U387A0A380U387_ACTLI50S ribosomal protein L15Actinobacillus lignieresii720UniRef100_A3N376
144
I3DKW2I3DKW2_HAEPH50S ribosomal protein L15Haemophilus parahaemolyticus HK3851095744UniRef100_I3DKW2
144
A0A369Z8M4A0A369Z8M4_HAEPH50S ribosomal protein L15Haemophilus parahaemolyticus735UniRef100_I3DKW2
144
A0A547GEG2A0A547GEG2_MANHA50S ribosomal protein L15Mannheimia haemolytica (Pasteurella haemolytica)75985UniRef100_A0A547GEG2
144
W0R814W0R814_BIBTR50S ribosomal protein L15Bibersteinia trehalosi USDA-ARS-USMARC-1901263832UniRef100_W0R814
144
M4RLS5M4RLS5_BIBTR50S ribosomal protein L15Bibersteinia trehalosi USDA-ARS-USMARC-1921171377UniRef100_W0R814
144
A0A4V7I7I2A0A4V7I7I2_BIBTR50S ribosomal protein L15Bibersteinia trehalosi USDA-ARS-USMARC-1881263829UniRef100_W0R814
144
A0A179CW99A0A179CW99_BIBTR50S ribosomal protein L15Bibersteinia trehalosi Y311261658UniRef100_W0R814
144
A0A3R8MK77A0A3R8MK77_BIBTR50S ribosomal protein L15Bibersteinia trehalosi (Pasteurella trehalosi)47735UniRef100_W0R814
144
I2NMX8I2NMX8_9PAST50S ribosomal protein L15Haemophilus paraphrohaemolyticus HK4111095743UniRef100_I2NMX8
144
A0A377J9A2A0A377J9A2_HAEPH50S ribosomal protein L15Haemophilus parahaemolyticus735UniRef100_I2NMX8
144
A0A328C1S5A0A328C1S5_9PAST50S ribosomal protein L15Glaesserella sp. HHC-20182094024UniRef100_A0A328C1S5
144
A0A377HZT2A0A377HZT2_HAEPH50S ribosomal protein L15Haemophilus parahaemolyticus735UniRef100_A0A377HZT2
144
A0A369ZRN9A0A369ZRN9_9PAST50S ribosomal protein L15Haemophilus paraphrohaemolyticus736UniRef100_A0A377HZT2
144
U4RT22U4RT22_HAEPR50S ribosomal protein L15Glaesserella parasuis str. Nagasaki1117322UniRef100_U4RT22
144
A0A0E1RRX5A0A0E1RRX5_HAEPR50S ribosomal protein L15Glaesserella parasuis 29755456298UniRef100_U4RT22
144
E0F6T6E0F6T6_ACTPL50S ribosomal protein L15Actinobacillus pleuropneumoniae serovar 10 str. D13039754259UniRef100_E0F6T6
144
A0A448KHA6A0A448KHA6_HAEDC50S ribosomal protein L15Haemophilus ducreyi730UniRef100_Q7VKF2
144
C5RZ98C5RZ98_9PAST50S ribosomal protein L15Actinobacillus minor NM305637911UniRef100_C5RZ98
144

Sequence

Representative sequenceiLengthMass (Da)Tools
A3N376

Checksumi: BCC4E64CD712F8C7

FASTA14414,989
        10         20         30         40         50
MRLNSLSPAE GAKHSAKRLG RGIGSGLGKT GGRGHKGQKS RTGGGVRRGF
60 70 80 90 100
EGGQMPLYRR LPKFGFTSLK SFHVAEIRLN DLAKVDGNEV TLESLKAANV
110 120 130 140
ITKDILSVKV ILAGKIEKAV VVKGLGVTKG AKAAIEAAGG SIEE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again