Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A7FZ57 50S ribosomal protein L5 n=28 Tax=Clostridium TaxID=1485 RepID=RL5_CLOB1 MMPRLQEKYEKEVVSALMDKFGYKNIMEVPKLEKIVINMGVGEAKENQKSLEAAVEDLAK ITGQKPILTKAKKSVANFKIREDMPLGCKVTLRKQNMYEFADKLINVALPRVRDFSGVSS KSFDGRGNYAIGIKEQLIFPEIEFDKIDKIRGMDIIFVTTAKTDEEARELLRFLGMPFAR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 7 of 7  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A7FZ57RL5_CLOB150S ribosomal protein L5Clostridium botulinum (strain ATCC 19397 / Type A)441770UniRef100_A7FZ57
180Representative & Seed
C3KVN9RL5_CLOB650S ribosomal protein L5Clostridium botulinum (strain 657 / Type Ba4)515621UniRef100_A7FZ57
180
A5I7J4RL5_CLOBH50S ribosomal protein L5Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)441771UniRef100_A7FZ57
180
C1FMT9RL5_CLOBJ50S ribosomal protein L5Clostridium botulinum (strain Kyoto / Type A2)536232UniRef100_A7FZ57
180
B1IGE2RL5_CLOBK50S ribosomal protein L5Clostridium botulinum (strain Okra / Type B1)498213UniRef100_A7FZ57
180
A7GJ62RL5_CLOBL50S ribosomal protein L5Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)441772UniRef100_A7FZ57
180
B1KSL3RL5_CLOBM50S ribosomal protein L5Clostridium botulinum (strain Loch Maree / Type A3)498214UniRef100_B1KSL3
180

Sequence

Representative sequenceiLengthMass (Da)Tools
A7FZ57

Checksumi: 49A3989DF0169CED

FASTA18020,512
        10         20         30         40         50
MMPRLQEKYE KEVVSALMDK FGYKNIMEVP KLEKIVINMG VGEAKENQKS
60 70 80 90 100
LEAAVEDLAK ITGQKPILTK AKKSVANFKI REDMPLGCKV TLRKQNMYEF
110 120 130 140 150
ADKLINVALP RVRDFSGVSS KSFDGRGNYA IGIKEQLIFP EIEFDKIDKI
160 170 180
RGMDIIFVTT AKTDEEAREL LRFLGMPFAR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again