Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A8YXL7 50S ribosomal protein L5 n=20 Tax=Lactobacillus TaxID=1578 RepID=RL5_LACH4 MASYLAEEYKEKVAPALAEKFDYKSSMQIPKIDKIVLNMGVGDAVSNAKNLDEAVEELTL ISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFLYKLINVSLPRVRDFRGVST RSFDGRGNYTLGVKEQLIFLEIDFDKVNRTRGLDIVIVTTANTDEEARELLTQFGMPFAR

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 20 of 20  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A8YXL7RL5_LACH450S ribosomal protein L5Lactobacillus helveticus (strain DPC 4571)405566UniRef100_A8YXL7
180Representative & Seed
A0A1B2IRB1A0A1B2IRB1_LACHE50S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_A8YXL7
180
F0NUV2F0NUV2_LACHH50S ribosomal protein L5Lactobacillus helveticus (strain H10)767462UniRef100_A8YXL7
180
U6F3Z2U6F3Z2_LACHE50S ribosomal protein L5Lactobacillus helveticus CIRM-BIA 9511226334UniRef100_A8YXL7
180
U4QET3U4QET3_LACHE50S ribosomal protein L5Lactobacillus helveticus CIRM-BIA 9531226335UniRef100_A8YXL7
180
A0A0P0ECN9A0A0P0ECN9_9LACO50S ribosomal protein L5Lactobacillus gallinarum52242UniRef100_A0A0P0ECN9
180
A0A0D5MH53A0A0D5MH53_LACHE50S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_A0A0D5MH53
180
U6FU97U6FU97_LACHE50S ribosomal protein L5Lactobacillus helveticus CIRM-BIA 1011226336UniRef100_A0A0D5MH53
180
U6F7F0U6F7F0_LACHE50S ribosomal protein L5Lactobacillus helveticus CIRM-BIA 1041226333UniRef100_A0A0D5MH53
180
W5XDB6W5XDB6_LACHE50S ribosomal protein L5Lactobacillus helveticus H9767456UniRef100_A0A0D5MH53
180
A0A386RC83A0A386RC83_LACHE50S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_A0A386RC83
180
A0A0R1S236A0A0R1S236_9LACO50S ribosomal protein L5Lactobacillus psittaci DSM 153541122152UniRef100_A0A0R1S236
180
A0A1Y4UHP1A0A1Y4UHP1_9LACO50S ribosomal protein L5Lactobacillus gallinarum52242UniRef100_A0A1Y4UHP1
180
A0A2A7QXM4A0A2A7QXM4_9LACO50S ribosomal protein L5Lactobacillus sp. UMNPBX62042041UniRef100_A0A1Y4UHP1
180
A0A2A7QL87A0A2A7QL87_9LACO50S ribosomal protein L5Lactobacillus sp. UMNPBX172042030UniRef100_A0A1Y4UHP1
180
A0A0R1P631A0A0R1P631_9LACO50S ribosomal protein L5Lactobacillus gallinarum DSM 10532 = JCM 20111423748UniRef100_A0A0R1P631
180
A0A3S8SE34A0A3S8SE34_LACHE50S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_A0A3S8SE34
180
A0A0R2MV77A0A0R2MV77_LACHE50S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_A0A0R2MV77
180
I7LB18I7LB18_9LACO50S ribosomal protein L5Lactobacillus pasteurii DSM 23907 = CRBIP 24.761423790UniRef100_I7LB18
180
UPI000BE8109950S ribosomal protein L5Lactobacillus helveticus (Lactobacillus suntoryeus)1587UniRef100_UPI000BE81099
180

Sequence

Representative sequenceiLengthMass (Da)Tools
A8YXL7

Checksumi: 1F2B67BBBCCFD58F

FASTA18020,277
        10         20         30         40         50
MASYLAEEYK EKVAPALAEK FDYKSSMQIP KIDKIVLNMG VGDAVSNAKN
60 70 80 90 100
LDEAVEELTL ISGQKPLITK AKKSIANFRL REGMSIGAKV TLRGDRMYDF
110 120 130 140 150
LYKLINVSLP RVRDFRGVST RSFDGRGNYT LGVKEQLIFL EIDFDKVNRT
160 170 180
RGLDIVIVTT ANTDEEAREL LTQFGMPFAR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again