Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_A9ZTN0 Major capsid protein (Fragment) n=4 Tax=Myoviridae environmental samples TaxID=336724 RepID=A9ZTN0_9CAUD TGPTGLIFALRSRYSNQTGSENFYNEVNTSFSSVVSGANTLGQKHVGTVPGNTTQTTNLA ATGLYNFGSGMSTAQAEALGTDSNAAIAQMGFSIEKVTATAKARGLAASYTLEIAQDLKA IHGLDVETELSNILTT

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A9ZTN0A9ZTN0_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_A9ZTN0
136Representative & Seed
A9ZTL6A9ZTL6_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_A9ZTL6
136
A8R7I5A8R7I5_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_A9ZTL6
136
B3Y8Z4B3Y8Z4_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_A9ZTL6
136

Sequence

Representative sequenceiLengthMass (Da)Tools
A9ZTN0

Checksumi: 5EBB281BD2E64174

FASTA13614,069
        10         20         30         40         50
TGPTGLIFAL RSRYSNQTGS ENFYNEVNTS FSSVVSGANT LGQKHVGTVP
60 70 80 90 100
GNTTQTTNLA ATGLYNFGSG MSTAQAEALG TDSNAAIAQM GFSIEKVTAT
110 120 130
AKARGLAASY TLEIAQDLKA IHGLDVETEL SNILTT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again