Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef90_B3Y8T7 Major capsid protein (Fragment) n=5 Tax=Myoviridae environmental samples TaxID=336724 RepID=B3Y8T7_9CAUD TGPTGLIFALKSRYTSQGGDEALFYEANTAFSSAALGGSQTGTRPAGNSTAAANSTNYTY ATGMTTLQGEGLGSSGNTAIPKMAFSIDKVTVTAKTRKLKAEYTIEIAQDLKAVHGLDAE TELANILSA

Members

Expand cluster to 50% identity.
List component clusters with 100% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B3Y8T7B3Y8T7_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8T7
129Representative & Seed
B3Y8T6B3Y8T6_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8T6
129
B3Y8T2B3Y8T2_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8T2
129
B3Y8T5B3Y8T5_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8T2
129
B3Y8R7B3Y8R7_9CAUDMajor capsid protein (Fragment)Myoviridae environmental samples336724UniRef100_B3Y8R7
129

Sequence

Representative sequenceiLengthMass (Da)Tools
B3Y8T7

Checksumi: B0B7402CF3DBDDE0

FASTA12913,260
        10         20         30         40         50
TGPTGLIFAL KSRYTSQGGD EALFYEANTA FSSAALGGSQ TGTRPAGNST
60 70 80 90 100
AAANSTNYTY ATGMTTLQGE GLGSSGNTAI PKMAFSIDKV TVTAKTRKLK
110 120
AEYTIEIAQD LKAVHGLDAE TELANILSA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again